KEGG   Rattus norvegicus (rat): 309620
Entry
309620            CDS       T01003                                 

Gene name
Btnl2, BTL-II, Ng9
Definition
(RefSeq) butyrophilin-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 C2-set_2 Adeno_E4
Other DBs
NCBI-GeneID: 309620
NCBI-ProteinID: NP_446267
RGD: 620731
Ensembl: ENSRNOG00000028541
Vega: OTTRNOG00000001682
UniProt: A0A0A0MY44
Position
20p12
AA seq 513 aa
MVDFPGYSLSGVAASFLFVLLTMKHPDDFRVVGPALPILANVGEDALLTCRLLPKRTTAR
MEVRWYRSDPDTPVMLYRDGAEVPGLAMEGYRGRVEWMEDSTEEGSVALKIRQVQPGDDG
QYWCRIQEGDYWREASVLLQVAALGSSPNIHVEGPGEEGVQLVCTSRGWFPEPEVYWEGI
RGEKLMSLSENHVYGEDGLFSVEDTLVVRNDSVETISCFIYNRGLREPQEATIALPEKLQ
TELASSRVIGPSQAIPVRVGETIELTCQLSPQTDAQSLEVRWLRARYYPVVHVYTNGAHE
AGEQMAEYRGRTSLVTDAIHEGKLTLQIHNARTSDEGQYRCLFGKDGVYQEARVDVQVMA
VGSTPQITREVLKDGGTQLRCTSDGWFPRPHVQWRDRDGRTLPSFSEAFRQGSQELFQVE
TLLLVTNGSMVNVTCSISLPLGEEKTARFPLSDSRIALLWMTLPVLVLPLAMAVDLIKVK
RRTKDQKHNGNRENDRNGESQRRRLSSDDERLR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggtggatttcccaggctacagtctatctggcgtagctgcctccttcctcttcgttctg
ctgactatgaagcacccagatgacttcagagtggtcggtcctgccctccctatcctggcc
aatgttggagaagacgcactgctaacgtgtcggcttctccccaagaggacaacagcacgc
atggaggtgaggtggtaccgctccgaccctgacacgcctgtgatgctgtaccgggatgga
gctgaggtgcctgggctagcgatggagggctacagaggccgggtagagtggatggaggac
agcactgaagaggggagtgtggctctgaagattcgacaggtgcagccaggtgacgatggc
cagtactggtgccgcatccaggagggagactactggagagaggcaagtgtgctactccaa
gtggcagctctaggatcctccccaaacatccatgtggaggggcccggagaagaaggggtc
cagctcgtgtgcacgtcccgaggctggttccctgagccggaggtctattgggagggcatc
aggggagagaagttgatgagtctctctgagaaccatgtgtacggtgaagatgggctgttc
tctgtggaagacacactggtggtcaggaacgacagtgtagagacgatttcctgcttcatc
tacaatcgtggcctcagagagccccaagaggccaccattgcccttccagagaaactccag
acagaactggcttcctcgagggtaatcggaccttcccaagccatccctgtccgagtcgga
gagaccatagaattaacttgtcagctctcacctcaaacggacgctcagagcttggaggtg
aggtggctccgagcccgctattaccctgtagtccacgtgtatacaaatggggcccatgag
gccggagagcagatggcagaatacagagggaggacttcactggtgactgacgccatccac
gaaggaaaactgaccctgcagatccacaacgccagaacttcggatgaggggcagtaccgg
tgcctttttggaaaagatggtgtctaccaggaggcccgtgtagatgtgcaggtgatggcg
gtgggttccaccccacagatcaccagggaggtcttgaaagatggaggaacacagctgagg
tgtacgtccgatgggtggttcccacgaccccacgtgcagtggagggacagagacggaagg
accctgccatcgttttctgaggcctttcggcaaggaagccaggagctgttccaggtggag
actctcctgctggtcacaaatggctccatggtgaatgtgacctgctccatcagcctccct
ctgggcgaggagaaaactgcacgttttcctctctcagactccaggatagctttgttatgg
atgaccctgcctgtcctggtgctgcctctcgccatggctgtcgacctgatcaaggtgaaa
cggcggacgaaagaccaaaaacacaacggcaatcgggaaaatgacaggaatggtgaaagc
caaaggcgaaggctttcctctgatgatgagaggctcagataa

DBGET integrated database retrieval system