KEGG   Rattus norvegicus (rat): 309629Help
Entry
309629            CDS       T01003                                 

Gene name
Pfdn6, Ke2
Definition
(RefSeq) prefoldin subunit 6
  KO
K04798  prefoldin beta subunit
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    309629 (Pfdn6)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  GimC
   309629 (Pfdn6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prefoldin_2 Prefoldin Occludin_ELL APG6_N YscO ADIP GAS FliJ DUF1732 BRE1 Prefoldin_3 DUF641 OmpH Spc24 DUF2089 ALIX_LYPXL_bnd FlaC_arch Fib_alpha EzrA DUF1664 SKA1 DUF3450 THOC7
Motif
Other DBs
NCBI-GeneID: 309629
NCBI-ProteinID: NP_001158190
RGD: 1303006
Ensembl: ENSRNOG00000000473
Vega: OTTRNOG00000001943
UniProt: Q6MGC4
Position
20p12
AA seq 127 aa AA seqDB search
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLL
GPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQN
AKAPGKA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactgatccaaaagaagctgcagggagaggtagagaaatatcaacagctgcag
aaggacttgagtaaatccatgtcagggaggcagaagcttgaagcccagctaacggaaaat
aacattgtgaaggaggaactggccttgctggatggatccaacgtggtctttaagcttctg
ggacccgtgcttgtcaaacaggagctgggggaggctcgggccacagtggggaagaggcta
gactacatcacagcggaaattaagcgctacgaatcgcagcttcgggacctcgaaaggcag
tcagagcaacagagggaaacccttgctcagttgcagcaggagttccagcgggcccagaac
gcaaaggctcccgggaaagcctga

DBGET integrated database retrieval system