KEGG   Rattus norvegicus (rat): 309638
Entry
309638            CDS       T01003                                 

Gene name
Taf11
Definition
(RefSeq) TATA-box binding protein associated factor 11
  KO
K03135  transcription initiation factor TFIID subunit 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    309638 (Taf11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    309638 (Taf11)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     309638 (Taf11)
SSDB
Motif
Pfam: TAFII28 CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 309638
NCBI-ProteinID: NP_001008351
RGD: 1305626
Ensembl: ENSRNOG00000024601
UniProt: Q5U1X0
Position
20p12
AA seq 211 aa
MDNLGESPTDKAGEPGESEETRATPGAPVSADTEGIPEETDQVGDADSKEAAAEESELKS
QDVSDVTAAEREDPSLLTPAAKKLKLDTKDKKEKKQKVDEDEIQKMQILVSSFSEEQLNR
YEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMP
PLQPKHMREAVRRLKSKGQIPNSKHKKITFF
NT seq 636 nt   +upstreamnt  +downstreamnt
atggacaaccttggggagtcgcccacggacaaagccggggagccaggggagtcagaggag
acgagggctactcctggggccccggtgtccgccgacactgagggaatcccggaggaaacc
gaccaggttggagacgcggactcgaaagaagccgcagcggaggaaagcgagctcaagagt
caggatgtctcagacgtaacagcagctgagagggaagacccatctttacttactcctgca
gccaaaaagctgaaattagacaccaaggacaagaaggagaagaagcagaaggtggacgaa
gacgagattcagaagatgcaaatcctggtctcgtctttctctgaggagcagctgaaccgt
tatgaaatgtatcgccggtcagctttccctaaggcggccatcaagcggctgatccagtcc
atcactggcacgtctgtgtcccagaatgttgtcattgccatgtctgggatctctaaagtt
tttgtcggggaggtggtagaggaggccctggatgtgtgtgagaaatggggagaaatgcca
cccctgcagcccaagcacatgagggaggccgtccggaggttgaagtccaaggggcaaatc
cccaactcaaagcacaagaaaatcaccttcttctag

DBGET integrated database retrieval system