KEGG   Rattus norvegicus (rat): 309678Help
Entry
309678            CDS       T01003                                 

Gene name
Trappc10, Tmem1
Definition
(RefSeq) trafficking protein particle complex 10
  KO
K20307  trafficking protein particle complex subunit 10
Organism
rno  Rattus norvegicus (rat)
Brite
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    309678 (Trappc10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAPPC10 Foie-gras_1 SNAP
Motif
Other DBs
NCBI-GeneID: 309678
NCBI-ProteinID: NP_001166999
RGD: 1311263
Ensembl: ENSRNOG00000023210
UniProt: F1MAQ4
Position
20p12
AA seq 1259 aa AA seqDB search
MDAPEEPQPPVVYTMENKPIVTCAGDQNLFTSIYPTLSQQLPREPMEWRRSYGRAPKMIH
LESNFVQFKEELLPKEGNKALLTFPFLHIYWTECCDTEVYKATVKDDLTKWQNVLKAHSS
VDWLIVVVENDAKKKNKTNILPRTSIVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWN
AFLTKLRTLLLMSFTKNLGKFEDDMRTLREKRTEPGWSFCEYFMVQEELAFVFEMLQQFE
DALVQYDELDALFSQYVVNFGAGDGANWLTFFCQPVKSWNGLVLRKPIDMEKRELIQKQE
ATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHSCVQELKLLEVSVPPGALDCWVFL
SCLEVLQRIEGCCDRAQIDSNIAHMVGLWSYAMEKLKSLGYLCGLVSEKGPNSEDLNRTV
DLLAGLGAERPETANTAQSPYKKLQEALSSVEAFEKHYLDLSHATIEMYTSIGRIRSAKL
VGKDLAEFYMRKRSPQKAEMYLQGALKNYMAEGWALPVTHTRKQLAECQKHLGQMENYLQ
TSSLLASDHHLTEEERKHFCQEILSFASQQEDKAGHKVVLPMHSFARLKDLHFDPPNAVV
HAGGVLTVEITVCSQMPVPVHVDQIAVNVHFSIEKNNYRKTAEWLTKHKTSNGVITFPAE
ASLFPAPQNSLPALELSEMLERSPSDNSLNTTGIICRNVHMLLRRQESGSSLEPPSGLAL
EDGAHVLRCTSVTLQPGANKIVFKTQAKEPGTYTLRQLRASVGPVWFVLAHIHPIVQYDV
YSQEPQLHVEPLADSLLAGIPQKVKFTVTTGHYTVKDGDSLQLSNVEAMLILCQAENRAV
VYSNTREECSSALLRIQSSDKVTSIGLPTAPAYHVIEFELEVLSLPSAPAAVEDSSILGT
PELHRKQKDSQRADHCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTAHSLLSAGTRKYV
QVCVQNLSELDFELSDSNLEDKGHATDLRLVPLNTQSQQLIHSKQSVFFVWELTWTQEPP
PPLHCRFSVGFSPASAERLTVSLKPYTYEFQVESFFTLYSVRAEILPASGAEFCKTGSLC
SLEVCITRLADLLDVDKDEALVESEDYFSTKLMYEVVDNSSNWAVCGKSCGVIAMPLAAQ
ATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHASQLDADSWIENDSLSVDKHLDDQLD
CSSLRSRGSAHSTSSGEHKGLPMPRLQALPAGQVFNSSTGMQILVIPSQDDHVLEVSVT
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccctgaggagccacagccaccggtggtctacaccatggagaacaagcctatc
gtcacctgtgctggagaccagaatttatttacctccatctatccgacactttcccagcag
cttccaagagaaccaatggagtggagaaggtcctatggccgggctccgaaaatgattcac
ctggaatccaactttgttcagttcaaggaggagctgctgcctaaggaagggaacaaagcc
ctgctcaccttccccttcctccacatctactggacggagtgctgtgacactgaagtatac
aaagctacggtaaaagacgacctcaccaagtggcagaatgttctcaaagctcacagctct
gtggattggctgatagtggtagtagaaaatgatgccaagaaaaaaaacaaaaccaacatc
cttcccagaacttctattgtggacaaaataagaaatgacttttgtaataaacagagtgac
aggtgtgttgtgctctctgaccccttgaaggactcttctcgaactcaggaatcctggaat
gccttcctgaccaaactcaggactctgctgctcatgtcttttaccaaaaaccttggcaag
tttgaggatgacatgcggactttgagggaaaagaggacagagccaggctggagcttctgt
gaatacttcatggtccaggaggagcttgcctttgtgtttgagatgctgcagcagtttgaa
gacgccctggtgcagtacgacgagctggacgccctgttctcacagtatgtggtcaacttc
ggagctggggatggtgccaactggctgacttttttctgccagccggtgaagagctggaat
ggactggtactccgcaagcccatagacatggagaagcgcgagttgattcagaagcaagag
gccactctgctggacctgcgaagctacctgttctcccgccagtgcaccttgcttctcttc
ctgcagcggccatgggaggtggctcagcgcgccctggagctgctgcacagctgtgtgcag
gagctgaagctcttagaagtctctgtccctcctggagctctggattgctgggtctttctg
agctgtctggaggtcttgcagaggatagaaggttgctgtgaccgggcacagatagactcc
aacattgcccacatggtgggactgtggagctatgccatggaaaagctaaagtccttaggg
tacctctgtggacttgtgtcagaaaaagggcccaactcggaagatctcaacaggacggtt
gatcttttggcgggactaggagcggagagacctgagacagccaacacagctcagagtcct
tataagaagctccaggaagcgctgtcatcagtagaggcctttgagaagcactacctggac
ttgtcccatgccaccattgagatgtatacaagtatcgggcggattcggtctgccaagctt
gttggaaaagatctggcagaattttacatgaggaaaaggtcgccacagaaggcggaaatg
tatcttcagggagctttgaaaaattacatggctgagggctgggccctgcctgtcacacac
acaaggaagcagctagccgagtgccaaaaacacctggggcaaatggaaaactacttgcag
accagcagcctcctggccagcgaccatcacctgacggaggaggagcggaagcacttctgc
caggagatcctcagctttgccagtcagcaggaggacaaggcaggtcacaaggtggtactg
cccatgcactcgtttgcacggctaaaggatctccattttgaccctcccaatgctgtggtc
cacgcgggtggcgtcctcactgtggagataacggtttgcagccagatgcctgtccctgtc
catgtggaccagattgctgtgaacgtccacttcagcattgaaaaaaacaactaccggaag
acagctgagtggctgaccaagcacaagacttccaatggagtcatcaccttcccagccgag
gcctccctgttccctgcacctcagaacagcctgccggccctggagctgtcagagatgttg
gagagaagcccctctgataactccctgaacaccacaggcatcatctgtaggaacgtccac
atgctcctaaggaggcaggagagtggctcttctctagagccgccctcggggctggccctg
gaggacggggcccacgtgctgaggtgcaccagtgtgactctgcagccaggcgccaacaag
atagtcttcaagacccaggccaaagaacctggaacatatacgctgcgacagcttcgggcc
tcggtgggccctgtgtggtttgtccttgcacacatccaccccattgtacagtatgatgtg
tactctcaggagcctcagctgcatgtggaaccgctggctgatagccttttggccggcatt
cctcagaaagtcaagtttactgtcactaccggccattacacagtaaaagacggagacagc
ctccagctcagcaatgtggaggccatgctcatcttgtgtcaggcggagaacagggccgtg
gtctactctaacacaagagaagagtgctcctctgccttgctccggatccagtcctctgac
aaggtgaccagcatcggtctccccactgcgcctgcgtaccacgtgatcgagtttgagctg
gaggttctgtctttaccttcagccccagcagctgtcgaggattccagtattctggggaca
ccagagctccacaggaagcagaaagattctcagagagctgaccattgcatggtcaccaca
gatcacaaggtgtccatcgactgcccgtggtctatctactccactgtcatcgcactgaca
ttcagtgtgcccttcaggaccgcgcactctctgctgtccgctggaacccggaaatatgtg
caagtctgtgttcagaacctatcggaactggactttgagctgtcagatagtaatctggaa
gacaaaggccatgctactgacctgaggctggtgcccctgaacacacagtcccagcagctt
atccacagcaagcagtccgtgttctttgtctgggagctgacgtggacacaggagccaccc
cctcctctgcactgccgcttctcagtggggttctccccagcttctgcagagcggctgact
gtctccctgaagccctacacctacgagttccaagtggagagcttttttacgctgtacagt
gtgagagctgagatccttcctgcctcaggagccgagttctgtaagacaggctcgctctgc
tccttggaggtgtgcatcacacggctcgccgacctcctggatgtggacaaggacgaagca
ctggtggagtctgaggactatttttccacaaagcttatgtacgaagttgtggacaacagc
agcaactgggctgtctgtgggaagagctgtggtgtcatcgccatgcctttggctgcccag
gctactcacagagtccacatggaagtgatgcctctgtttgctggttacctccccttgcct
gatgtccgactgttcaagtaccttccccaccactctgctcatgcctctcaactggacgct
gacagctggatagaaaatgacagcctgtcagtggacaagcacctagacgaccagctggac
tgcagcagcttgcggagcagaggcagtgcacactccacttccagcggcgagcacaaaggc
ttgccgatgccccggctccaggcactgcccgctggccaggtcttcaactccagcactggc
atgcagatcctggtcattcccagtcaagacgaccacgtcctggaagtcagtgtcacctga

DBGET integrated database retrieval system