KEGG   Rattus norvegicus (rat): 309684
Entry
309684            CDS       T01003                                 

Gene name
Itgb2
Definition
(RefSeq) integrin beta-2 precursor
  KO
K06464  integrin beta 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04390  Hippo signaling pathway
rno04514  Cell adhesion molecules
rno04610  Complement and coagulation cascades
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05133  Pertussis
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05144  Malaria
rno05146  Amoebiasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05166  Human T-cell leukemia virus 1 infection
rno05323  Rheumatoid arthritis
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    309684 (Itgb2)
   04390 Hippo signaling pathway
    309684 (Itgb2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309684 (Itgb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    309684 (Itgb2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    309684 (Itgb2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    309684 (Itgb2)
   04613 Neutrophil extracellular trap formation
    309684 (Itgb2)
   04650 Natural killer cell mediated cytotoxicity
    309684 (Itgb2)
   04670 Leukocyte transendothelial migration
    309684 (Itgb2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309684 (Itgb2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    309684 (Itgb2)
   05134 Legionellosis
    309684 (Itgb2)
   05150 Staphylococcus aureus infection
    309684 (Itgb2)
   05152 Tuberculosis
    309684 (Itgb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    309684 (Itgb2)
   05144 Malaria
    309684 (Itgb2)
   05140 Leishmaniasis
    309684 (Itgb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    309684 (Itgb2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309684 (Itgb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309684 (Itgb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309684 (Itgb2)
   04515 Cell adhesion molecules [BR:rno04515]
    309684 (Itgb2)
   04090 CD molecules [BR:rno04090]
    309684 (Itgb2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    309684 (Itgb2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   309684 (Itgb2)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   309684 (Itgb2)
CD molecules [BR:rno04090]
 Proteins
  309684 (Itgb2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 309684
NCBI-ProteinID: NP_001032869
RGD: 1305581
Ensembl: ENSRNOG00000001224
UniProt: B2RYB8
Position
20
AA seq 768 aa
MLGPHTLLLILAGLLFLGSALSEECTKYKVSNCRDCIQSGPGCSWCQKLNFTGPGEPDSL
RCDTRAQLLLKGCPADDIMDPKSFADLHPQYQVQRSQLSPQKVTLNLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAI
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKKAY
YKLSSRVFLDHTTIPDTLKVTYDSFCNNRVSSIGKSRGDCDGVQINNPVTFQVKVTASEC
IQEQSFVIRALGFTDTVTVQVHPQCECQCRDQSRMRNLCGGKGVMECGICRCESGYIGKN
CECQTQGRSSQELEGNCRKDNSSIVCSGLGDCICGQCVCHTSDIPNKVIFGQYCECDNFN
CERYDGQVCGGLKRGSCSCGQCNCKEGFEGSACQCQRSTTGCLNARLVECSGRGRCQCNR
CICEKGYQPPLCEECPGCPLPCSTYVFCAECLKFDKGPFQKNCSVQCANVTLQTVPFKKK
PCKERDSEGCWITYTLQQKDGNAYNIHVDDDRECVKGPNVAAIIGGTVAGVVLIGVLLLV
IWKALTHLTDLNEYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgctgggcccacacacactgctactcatcctagctggactactcttcctgggatctgcc
ctgtccgaggaatgcaccaagtacaaagtcagcaactgccgggactgtatccagtcgggg
cctggctgctcgtggtgccagaagctgaacttcaccggaccaggggagcctgactccttg
cgctgtgacacgcgggcacagctgctcctcaagggttgcccagccgatgatataatggac
cccaagagctttgctgatctccacccccaatatcaggtgcaacggagtcaactgtctcca
caaaaagtgacccttaacttgcgaccagggcaggctgctgcattcaatgtgactttccga
cgggccaagggctaccccattgatctgtactacctcatggacctctcctactctatgctc
gatgacctgaacaatgtcaagaagttgggtggtgatttgctgcaggccctcaacgagatc
acagagtccggccgcatcggcttcgggtccttcgtggacaagacggtgctgccttttgtc
aacacccatcccgagaagctgaggaacccatgccccaacaaggagaaagcctgccagcct
ccgtttgcctttcgccacgtgctcaagctaaccgacaactccaaccagtttcagacagag
gtcggcaagcaactgatttccggaaacctggacgcccctgagggcgggctggatgccata
atgcaagtggctgcctgtccggaggaaattggctggcgcaatgtcacgaggctgctggtg
tttgccacagacgacggcttccactttgccggtgatgggaaactgggtgccatcctgacc
cccaacgatggccgctgccacctggaggataacatgtacaagaggagcaatgagttcgac
tacccgtcagtgggccagctggcccacaaactttccgagagcaacatccagcccatcttt
gcagtgacaaagaagatggtgaaaacctatgagaaactgacagagattatccccaagtca
gcggtgggcgagctgtctgacgattccagtaacgtagtccagcttatcaagaaagcctac
tacaaactctcctctagagtcttcctggaccacaccaccatcccggacaccctgaaagtc
acctatgactccttctgtaataacagagtatcgagtataggcaaatcccgaggggactgt
gacggtgtgcagatcaacaacccggtcaccttccaggtaaaggtcacggcttcggagtgt
atccaggagcagtcctttgtcatccgggcgctgggcttcaccgacacagtgacggtacag
gtccatccccagtgcgagtgccagtgccgggaccagagtcggatgaggaatctctgtgga
ggcaagggagtcatggagtgtggcatctgcaggtgtgagtctggctacattgggaaaaac
tgtgagtgtcagacgcagggccggagcagccaggagctggaggggaactgccggaaggac
aatagttccattgtgtgctcggggctgggggactgcatctgcgggcagtgcgtgtgccac
acgagtgacatccccaacaaagtgatctttgggcaatactgcgagtgtgacaacttcaac
tgtgagagatatgatggccaagtctgcggtggcctaaagagaggctcctgctcctgtggc
cagtgtaattgcaaggagggtttcgagggttctgcttgccagtgtcagaggtctaccacg
ggctgtctgaacgcacggctggtggagtgcagtggccgtggccggtgccaatgcaacaga
tgcatctgtgagaaaggttaccagccacctctgtgtgaagagtgtcccggctgccccttg
ccctgcagcacctacgtcttctgtgccgagtgcctgaaatttgataagggcccctttcag
aagaattgtagtgttcagtgtgccaatgtgacgctgcagactgtccctttcaagaaaaag
ccctgcaaggagagggactcggagggctgctggataacctacactttgcagcagaaggac
ggaaacgcttacaacatccatgtggacgacgatcgagagtgtgtgaaaggccccaacgtg
gctgccatcatagggggcactgtggccggcgttgtactgattggtgtcctcctcctggtc
atctggaaggctcttacccacctgactgacctcaatgaatacagacgctttgagaaggag
aaactcaagtcccagtggaacaacgacaaccccctcttcaagagcgccacgacaacggtc
atgaaccctaagtttgctgagagctag

DBGET integrated database retrieval system