KEGG   Rattus norvegicus (rat): 309757
Entry
309757            CDS       T01003                                 

Gene name
Sirt1
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
rno04068  FoxO signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04922  Glucagon signaling pathway
rno05031  Amphetamine addiction
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    309757 (Sirt1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    309757 (Sirt1)
   04152 AMPK signaling pathway
    309757 (Sirt1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    309757 (Sirt1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    309757 (Sirt1)
  09149 Aging
   04211 Longevity regulating pathway
    309757 (Sirt1)
   04213 Longevity regulating pathway - multiple species
    309757 (Sirt1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    309757 (Sirt1)
  09165 Substance dependence
   05031 Amphetamine addiction
    309757 (Sirt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    309757 (Sirt1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    309757 (Sirt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     309757 (Sirt1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     309757 (Sirt1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    309757 (Sirt1)
SSDB
Motif
Pfam: SIR2
Other DBs
NCBI-GeneID: 309757
NCBI-ProteinID: NP_001359019
RGD: 1308542
Position
20
AA seq 444 aa
MCLCSGRKAILEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCH
GSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFH
RAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCD
VIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPER
TVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVG
SSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDD
ALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEA
VNEAIAMKQELTDVNCTPDKSEHY
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtgcctgtgcagtggaaggaaagcaattttggaaatatatcccggacagttccagcca
tctctgtgtcacaaattcatagctttgtcagataaggaaggaaaactacttcgaaattat
actcaaaatatagataccttggagcaggttgcaggaatccaaaggatcattcagtgtcat
ggttcctttgcaacagcatcttgcctgatttgtaaatacaaagttgattgtgaagctgtt
cgtggagatatttttaatcaggtagttcctcggtgtcctaggtgcccagctgatgagcca
cttgccatcatgaagccagagattgtcttctttggtgaaaacttaccagaacagtttcat
agagccatgaagtatgacaaagatgaagttgacctcctcattgttattgggtcttctctg
aaagtaagaccagtagcactaattccaagttctataccccatgaagtgcctcaaatatta
ataaatagggaacctctgcctcatctacattttgatgtagagcttcttggagactgcgat
gtcataattaatgagttgtgtcataggttaggtggcgagtatgccaaactttgttgtaac
cctgtaaagctttcagaaattactgaaaaacctccacgaacacaaaaggaattggttcat
ttatcagagttgccaccaacacctcttcatatttcagaagactcaagttcacctgaaaga
actgtaccacaagactcttctgtgattgctacacttgtagaccaaacaataaagaacaaa
gttgacgatttagaagtatctgaaccaaaaagttgtgtggaagaaaaatcacaggaagta
cagacttataggaatgttgagagcattaatgtggaaaacccagatttcaaggctgttggt
tccagtactggagacaaaaatgaaagaacttctgttgcagaaacagtgagaaaatgctgg
cctaatagacttgcaaaggagcagattagtaagcgtcttgacggtaatcaatacttgttt
gtaccaccaaatcgttacatatttcatggtgctgaggtatactcagactctgaagatgac
gccttatcctctagttcctgtggcagtaacagtgacagtggcacatgccagagtccaagt
ttagaagaacccttggaagatgaaagtgaaattgaagagttctacaatggcttggaagat
gatgctgacagaccggagtgtgctggaggatctggagctgacggaggggatcaagaggca
gttaatgaagctatagccatgaaacaggaattaacagatgtaaactgtacaccagacaaa
tcagagcactattga

DBGET integrated database retrieval system