KEGG   Rattus norvegicus (rat): 309774Help
Entry
309774            CDS       T01003                                 

Gene name
Gopc
Definition
(RefSeq) golgi associated PDZ and coiled-coil motif containing
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 DUF903 bZIP_2 JAKMIP_CC3 TMCO5 NRBF2
Motif
Other DBs
NCBI-GeneID: 309774
NCBI-ProteinID: NP_001101101
RGD: 1309512
Ensembl: ENSRNOG00000000408
UniProt: B4F775
Position
20q11
AA seq 308 aa AA seqDB search
MEDLERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKEL
AGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRQDLKRPMQAPPGHDQ
DSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGD
AVLAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLY
LDELEGGGNSGASCKDSSGEMKVLQGYNKKTVRDAHENGDVGASGESPLDDTAVRAAHPH
SLHQKKAY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaggatctggaaagagaacttgaagcaaataaaacagaaaaggtaaaagaagctcgg
cttgaagctgaagtgaagctgctaaggaaagagaacgaggctcttcgcaggcacatagcc
gttctccaggctgaagtttatggggcgaggttggccgccaagtacttggacaaggagctg
gctggcagggtccaacaaatacagttactgggacgggatatgaagggacctgctcatgac
aagctctggaaccagttagaagctgaaatacatttgcatcgccacaaaacagtcatccga
gcctgcagaggacgccaggacctgaagcggcccatgcaggcacccccaggccacgatcaa
gactctttgaagaaaagccagggagttggtccaattagaaaagttctcctccttaaggaa
gatcatgaaggccttggcatttctattacaggtgggaaggagcacggtgtccccattctc
atctcggagatccatccaggacagcctgcggataggtgtggagggctccatgtcggagat
gctgttctggcagtaaatggcgttaacctaagggacacaaagcacaaagaagccgtgacc
atactttcccagcagagaggagagattgaatttgaagtagtctacgtggcccctgaagtg
gattctgatgatgaaaatgtcgagtatgaagacgagagtgggcaccgctaccgtttgtat
cttgatgagttagaaggcggtggtaattctggtgctagttgcaaagacagcagtggtgaa
atgaaagtgttacaaggatataacaagaagacggtgagggatgcccatgagaatggggac
gtgggggcttcgggtgaaagccctctggacgacactgctgtgagagcagctcatccgcac
agcctccatcagaagaaggcctactaa

DBGET integrated database retrieval system