KEGG   Rattus norvegicus (rat): 309798Help
Entry
309798            CDS       T01003                                 

Gene name
Gcc2
Definition
(RefSeq) GRIP and coiled-coil domain containing 2
  KO
K20282  GRIP and coiled-coil domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309798 (Gcc2)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    309798 (Gcc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rab_bind GRIP GAS DUF5597
Motif
Other DBs
NCBI-GeneID: 309798
NCBI-ProteinID: NP_001101103
RGD: 1305732
Ensembl: ENSRNOG00000000823
UniProt: D3ZZL9
Position
20q11
AA seq 1679 aa AA seqDB search
MEDSAQDAVTAAPSGTPKSKLETLPREDLIKFAKKQMMLLQKAKARCTELDKEVEELKSK
PVDGGTDDMIKVLTERLDALLLEKAETEQQCLCLKKENIKMKQEVEDSVTKLEETQKEFE
QSHRNYVREMESVKNELIAVHSEHSKEKAALQRDLEGAVHRQAELLEQLKSQSDSEDNVK
KLQEEIQNITAAFEEQTSCLQKQLEATSDEKQQEIIHLQKVIEDNAQHYQKDINTFQEEI
VQLRATHKEEVNELMSQMETLAKEHEAAVNKLKENRVTLCETSETIPENYQCESESLNED
TSDASQENQKCSVALQEDPFAEHTVYDKVRQLEDSLKELESQHSILKDEVTYMNNLKLKL
EMDAQHIKDEFFHEREDLEFKINELLLAKEEQSYVVEKLKYEREDLNRQLCCTVEQHNKE
IQRLQEHHQKEISELSETFMSGSEKEKLALMFEIQGLKEQCENLQHEKQEVVLNYESLRE
MMEILQTELGESAGKISQEFETMKQQQASDVHELQQKLRTAFNEKDALLETINRLQGENE
KLLSQELVSELESTMKNLKADNSMYLASLGQKDTLLQELEAKISSLAEEKDDFISKIKTS
REEIDDLHQKWEREQKLSVELREAAEQAAQHNSELRQRVSELTGKLDEILREKSQNDQNI
MVQMKTMTEDQEALSSKIKSLYEENNRLHSEKVQLSRDLEALQSQQDFAYKEHVAEFEKK
LQLMVEERDDLNKLLENEQLQKSFVKTQLYEFLKQMRPSILEDNEEEDVVTVLKAVGESL
VTVKEEKHNLVFEYDARVLELERRIKCLQEESVVQCEELRALVRDSEQEKILLRKELDEV
TSTKEALQCDILEMKNTNEKTSLENQTLSTRVEELSRSLHSKNEVHNEKDLVIEHENLRL
SLEQRESELQDVRAELMLLKDSLEKSPSVKNDQLSLVKELEEKIESLEKESKDKDEKISK
IKLVAVRAKKELDSNRKEAQTLRDELESVQSEKDRLSASMKEFIQGAESYKNLLLEYDKQ
SEQLDVEKERANNFEHHIEDLTKQLRDSTCQYEKLTSDNEDLLARIETLQANARLLEAQI
LEVQRAKGVVEKELEAEKLQKEQKIKEHVSTTNELEELQLQFQKEKKQLQKTMQELELVK
KDAQQTTLMNMEIADYERLMKELNQKLTNKNSKIEDLEQEMKIQKQKQETLQEEMTSLQS
SVQHYEEKNAQIKQLLVKTKKELADAKQAETDHLLLQASLKGELEASQQQVEVYKIQLAE
MTSEKHKIHEHLKTSAEQHQRTLSAYQQRVVALQEESRTAKAEQAAVTSEFENYKVRVHN
VLKQQKNKSVSQAETEGAKQEREHLEMLIDQLKIKLQDSQNSLQISVSEFQTLQSEHDTL
LERHNRMLQETVTKEAELREKLCSAQSENTMLKSEHAQTMCQLTSQNEALRNSFRDQVRH
LQDEHRKTVETLQHQLSKVETQLFQLKSEPPTKSPASSHQPSKSLRERRTTDLPLLDMHT
VTREEGEGMETTDSESVSSAGTHIQSLEQLLSSPDSKLERLTEASLWHTEFTKEELAEKL
SSTTKSADHLNGLLRETEATNAILMEQIKLLKSEIRRLERNQEREKSVANLEYLKNVLLR
FIFLKPGSERERLLPVIDTMLQLSPEEKGKLATVAQGEEESASRSSGWASYLHSWSGLR
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggaggattctgctcaagatgctgtgactgcagcaccctccgggaccccgaaatccaag
ctagaaacattgcccagagaagatctcatcaagtttgccaagaagcagatgatgctccta
cagaaagccaaagcaaggtgtacagaattagacaaagaagttgaagagctcaaatcaaaa
cctgttgacggaggaactgatgatatgattaaggtgctaactgaacgcttggatgctctt
cttctggaaaaagcagagactgaacaacagtgtctgtgtctcaaaaaagaaaatattaaa
atgaagcaagaggttgaggattctgtaactaaactggaagagacacaaaaagagtttgaa
caatcacatagaaactacgtaagagaaatggaaagtgttaaaaatgaactgatagcagta
cactcagagcacagcaaagaaaaggctgccttacaaagagacctggagggagcagtccat
aggcaagcagagctgttagaacagctcaagtctcagagcgactctgaagataatgttaaa
aaactacaggaagagattcagaacattacagcagcatttgaggaacaaacgtcatgtcta
caaaagcaattagaagctaccagtgatgaaaaacagcaagagattattcatctccagaaa
gtcattgaggacaacgctcagcactaccaaaaagatattaatactttccaagaagagatt
gtgcagctgagagctacacacaaagaagaagttaatgagctgatgtctcaaatggaaaca
ttagctaaagaacatgaggcagcagtaaataagctaaaagagaacagagtgacactgtgt
gagacaagtgagaccattccagagaattaccaatgtgaatcagaaagcttaaatgaagac
acctcagatgcaagccaggagaatcaaaaatgctctgtggccttacaggaagatcctttt
gcagaacatacagtgtatgataaagtcagacaattggaagattcattaaaagaactggaa
tctcaacatagtatcttaaaagatgaagtgacttatatgaataatctcaagttaaaactt
gaaatggatgcccagcatataaaggatgagtttttccatgaaagagaagacttggagttt
aaaattaatgaactgttgctggccaaagaagaacagagctacgtagtagaaaaattaaaa
tatgagcgagaagatttaaataggcagctttgctgtactgtggaacaacataacaaagaa
atacagcgtcttcaggagcaccatcagaaagaaatctctgaactaagtgagacatttatg
tcaggttcagaaaaagaaaagttagcattaatgtttgaaatacagggacttaaggaacag
tgtgaaaatctacaacatgaaaagcaagaggtagttctaaattatgagagtttacgagag
atgatggaaattttacaaacggaacttggagaatctgctggaaaaataagtcaagagttt
gaaacaatgaagcaacagcaagcatctgatgttcatgagcttcagcagaagctaagaact
gcttttaacgaaaaagacgctcttcttgaaactataaatcgcctacaaggagaaaatgaa
aaattattatcacaagaattggtatcagaactcgaaagtaccatgaagaaccttaaggca
gataatagcatgtacttagccagccttggtcaaaaagataccctgttacaagaattagaa
gcaaagataagttctcttgctgaagaaaaagatgattttataagtaaaatcaaaacttcc
cgtgaagagatagatgatctccatcagaaatgggaaagggaacagaaactgtctgtagaa
ctcagggaagcagcagagcaagccgcccagcacaacagtgaactgagacaaagagtaagt
gaattaacaggaaaactagatgaaatattaagagaaaagagtcaaaatgaccaaaacatt
atggttcaaatgaaaaccatgacagaagaccaagaagcattgtcatctaaaatcaagtct
ctttatgaggaaaacaatagactgcattctgaaaaggtccagttgagtagagatttagaa
gctcttcagtctcaacaagattttgcctataaagagcatgttgctgaattcgaaaagaaa
ctccagttaatggttgaagaacgagatgatttaaataaactgcttgaaaatgagcaactt
cagaagtcatttgtcaaaactcagttgtacgagtttcttaagcaaatgaggccaagcatt
ttagaagataatgaagaggaagatgttgtcacagttctaaaagctgtgggtgaatcctta
gtgacagtaaaggaagaaaagcataacttagtctttgaatatgatgcgagagtattagaa
ttagaaaggaggattaagtgccttcaagaggagagtgtagttcagtgtgaagaactaagg
gctttagtaagagactctgaacaagagaaaattctcctaagaaaagaattagatgaagtc
acatcaacaaaagaggccctgcagtgtgatattctagaaatgaagaatactaatgaaaaa
acaagccttgaaaatcagactctttcaactcgggttgaagaattatcgcggtcattacac
agcaaaaatgaagtccataatgaaaaggatcttgtcatagaacatgaaaacctgaggcta
tcgcttgagcagagggagtctgagctacaagatgtgagagcagaattgatgctgctgaag
gattccttagagaaatcgccttctgtaaaaaatgatcaactttcattggtaaaagagctg
gaagaaaaaatagaaagtctggaaaaagaatccaaagacaaggatgagaaaatcagtaag
ataaaactagtcgctgtgagagcaaagaaagaactagattctaacaggaaagaggcccag
acactacgggacgaactcgagtccgtacagtcagaaaaggaccgcttatctgcttctatg
aaggagtttatccaaggagcagaaagctataagaatcttctgttagaatatgacaagcag
tcagaacagctggatgtggaaaaagaacgtgctaataattttgaacatcacatagaagac
cttaccaaacaattaagagattcgacttgccagtatgaaaaactaacttccgacaatgag
gatctcctggctcgaattgagaccctgcaggctaatgccaggttattagaagcacagatc
ttagaggtccagagagccaaaggagtagtagaaaaagaactggaagctgaaaaacttcag
aaagagcagaaaattaaggaacatgtcagtactacaaatgagcttgaagaacttcaactc
caatttcaaaaggaaaagaagcagcttcagaaaacgatgcaagaattagaactggttaaa
aaggatgcccaacagaccacgttgatgaatatggaaatagcagattacgaacgtttgatg
aaagaattaaatcaaaagttaacaaataaaaacagtaagatagaagatttggagcaagaa
atgaaaattcagaaacagaaacaagaaaccctacaagaagaaatgacttccctgcagtct
tcagtacagcactacgaagaaaagaacgcccaaatcaagcagctgcttgtgaaaaccaaa
aaggaactggcagatgcaaagcaagcagaaactgatcacttactactccaggcgtcttta
aagggcgagctggaagcaagccagcagcaagtagaagtctataaaattcagctagctgag
atgacatctgagaaacacaaaatccatgagcacctgaagacttctgcggaacagcaccag
cgcacactaagtgcataccagcagagggtggtggccctgcaggaagagagccgcactgcc
aaggcagagcaagctgctgtcacctctgaatttgagaactacaaagtccgggttcataac
gttctaaaacaacagaaaaataaatctgtgtctcaggctgaaactgagggagctaaacaa
gaaagggaacacctggaaatgctgattgaccaactgaaaatcaagttacaggacagccaa
aacagcttacaaatcagtgtgtcagagttccagacactgcagtctgagcatgacactctg
ctagagaggcacaaccggatgctgcaggaaactgtgaccaaagaggcggaacttcgggaa
aagttatgttcagctcaatctgagaacaccatgttgaagtctgaacacgcccagacaatg
tgtcagctgacatcccagaatgaggccctccgtaacagcttccgagaccaagttcgacac
ttgcaggatgagcacagaaagacagtggagaccttgcagcaccagctctccaaggtggaa
actcagctcttccagctcaagagtgagccacccacaaaaagccctgcttcttcccatcaa
ccttcaaaaagcctccgagaaagacggaccacagacctcccccttctggacatgcacact
gtgacccgagaggagggggaagggatggagacaactgacagtgagtctgtgtcttcggcc
ggcacacacattcagtccttggagcagctccttagctctcctgacagcaagcttgaacgt
cttacagaggcctccttatggcatacagaatttaccaaagaagaattggctgagaagctc
agttccaccacgaagagtgcagatcacttaaatggcctgcttcgggagacagaggctacc
aacgccatccttatggagcaaattaagcttctcaaaagtgaaataagaagactggaaaga
aaccaagagcgggagaagtctgtggctaacctggagtacttgaagaatgtcctactgcgg
ttcattttcctgaagccgggtagtgaaagagagaggcttcttcctgtgatagacacgatg
ctgcagctcagccctgaagaaaagggaaagcttgccacagttgctcaaggtgaggaagaa
agtgcctctcgttcctctggatgggcatcctaccttcatagctggtctggactgcgatag

DBGET integrated database retrieval system