KEGG   Rattus norvegicus (rat): 309816
Entry
309816            CDS       T01003                                 

Gene name
Lama4
Definition
(RefSeq) laminin subunit alpha-4 precursor
  KO
K06241  laminin, alpha 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05143  African trypanosomiasis
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    309816 (Lama4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    309816 (Lama4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    309816 (Lama4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    309816 (Lama4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    309816 (Lama4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    309816 (Lama4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    309816 (Lama4)
   05145 Toxoplasmosis
    309816 (Lama4)
   05143 African trypanosomiasis
    309816 (Lama4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 Sec34
Other DBs
NCBI-GeneID: 309816
NCBI-ProteinID: NP_001296376
RGD: 1560062
Ensembl: ENSRNOG00000000599
Position
20
AA seq 1817 aa
MAWNTAWCSVLALWLLWGAVCSNAASGDGNAFPFDIEGSAVVGRQDPSETSDSRVTMGRL
PPAAERCDAGFFRTSSGECSPCDCNGNSHECLDGSGFCLHCQRNTTGEHCERCLAGYIGD
SIRGAPRFCQPCPCPLPHLANFAESCFRKNGAVRCMCKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFELPTGCDKCVWDLTDDLRLAALSIEESKSGLLSVSSGAAA
HRHVTDMNSTIHLLKTRLSERENQYTLRKIQINNSENTLRSLLSDVEELDEKGSRASRKG
TLVEKESTDTIDQATQLVEQAHSMRDKIQEINSKMLYYGENQELGPEEIAEKLVLAQKML
DEIRSRQPFLTHRELVDEEADEVQELLSQAENWQRLHNDTRSLLPVVLEQLDDYNAKLSD
LQESINQALDHVRDAEDMNRAITSKQRDHEKQHERVKEQMEAVGTSLSLSADSLITPRLT
LEELDEIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEAVDHAYNLQQEANELSRN
LHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYDAVSGIDTQIVYHKD
ESDNLLNQARELQAKADSSSDEAVADTSRRVGGALWRKGALRDKLTEAVKQLQAAERGDA
HQRLGQTKLIIEEANKTTMAVQQVTTPMANNLSNWSQNLQTFDSSAYNTAVNSARDAVRN
LTEVVPRLLGQLRTVEQKRPASNVSASIQRVRELIAQTRSVASKIQVSMLFDGHSAVEVH
PKVSVDDLKAFTSISLYMKPPPKPAEPTGAWVEDQFVLYLGSKTAKKEYMGLAIKNDNLV
YVYNLGTKDVEILLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGE
FAGDDSLLDLTPEDTVFYVGGVPANFKLPASLNLPSYSGCLELATLNNDVISLYNFKHIY
NMDPAKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEIRTPADN
GLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEISIIYHN
DKKMILVVDRRHVKSTDNEKKKIPFTDIYIGGAPQEVLQSRTLRAHLPLDINFRGCMKGF
QFQKKDFNLLEQKETLGVGYGCPEDSLISRRAYFNGQSFIASTQKISFFDGFEGGFNFRT
LQPNGLLFYYASGSDDVFSISLDNGTVVMDVKGIKVKSADKQYHDGLSHFVVTTVSATRY
ELVVDKSRLGSKNPTKGKAEPTQTTEKKFYFGGSPISPQYANFTGCISNAYFTRLDRDVE
VEDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTNKQGEKSKDAPSWDPIGLKF
LERKASRDSHCHLSSSPRAIEHAYQYGGTANSRQEFEHIQGDFGEKSQFAIRLKTRSSHG
MIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYSDGLWHDVIFIREKSSGR
LVIDGLRVLEERLPPSDAAWKIKGPIYLGGVAPGRAVKNVQINSVYSFSGCLGNLQLNGA
SIASASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLV
HGHSVNGEYLNVHMKSGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITVIRDSNVVQLD
VDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLTPSKPFTGCIRHFVIDGRPVSFS
KAALVSGAVSINSCPTA
NT seq 5454 nt   +upstreamnt  +downstreamnt
atggcttggaacacagcctggtgctcagtcctggccctgtggctcctctggggtgctgtc
tgctccaacgcggcgtcaggggacggcaatgcgtttccctttgacatcgaggggagcgca
gtggtcggcaggcaagacccatctgagaccagcgactcccgtgtgacaatgggacgcctg
ccgccagctgctgagagatgtgacgccggcttctttcgcacgtcatcaggagaatgttcg
ccctgtgactgtaacggcaattcccacgagtgtttggatggctccggattctgtctgcac
tgccagcggaacacaacaggggagcactgtgaaaggtgtctggctggctatattggagac
tccatcagaggcgcaccccgattctgccagccgtgcccctgtcccttacctcacctggcc
aactttgcagaatcctgcttcaggaaaaacggagctgttcggtgtatgtgtaaagaaaac
tatgctgggcctaactgtgaaagatgtgctcctggttactatggaaaccccctactcatc
ggaagcacctgtaagaaatgtgactgcagtggcaattcggatcccaacctcatctttgaa
gactgtgatgaaatcactggccagtgcaggaactgcttacgaaataccaccgggttcaag
tgtgaacgctgtgctcctggctattacggggatgccaggatcgccaagaactgtgcagtg
tgcaactgtgggggcggcccatgtgacagcgtaaccggagagtgcttggaagaaggattt
gaactccctacaggctgtgataagtgtgtctgggacttgaccgacgacctgcgattagca
gcgctctccatcgaagagagcaaatccgggctgctgagcgtgtcctccggcgctgcggcc
catagacacgtgaccgacatgaactctaccatccacctcctcaaaacaaggttgtcagaa
agagaaaaccagtataccctgagaaagatccagataaacaactcagagaacacactgaga
agcctcctgtctgacgtagaggaactggatgagaagggaagccgagcctcaaggaagggg
acgctggttgaaaaggaaagcacggatacaattgaccaggcaactcagctcgtcgagcaa
gcccacagcatgagggacaaaatccaagaaatcaatagcaagatgctttactatggagag
aatcaggaacttggccctgaggaaattgcggagaagctggtgttggcccagaaaatgctg
gatgagatccgaagccggcagccattcctcacccatcgggagcttgtggatgaggaggca
gatgaagtccaggaattgctgagccaagctgagaactggcagagactgcacaacgacacc
cgctctttactccctgtggtgttggagcagctggatgactacaatgctaagctgtcagac
ctccaggaatccattaaccaggcccttgaccatgtcagggatgcagaagacatgaacaga
gccatcacctcgaagcagcgggaccatgagaaacaacacgagagagtgaaggaacagatg
gaggccgtgggcacctctctgagtttgtctgcagactctctcatcacacctcggctcact
cttgaggaacttgatgagataataaagaatgcatctggaatttatgcagagatagatgga
gccaaaaacgaactacaggggaaactgtccaacctgagtaacctcagtcatgatttggtc
caagaagctgtggaccacgcgtacaacctccaacaggaagccaacgagctaagcagaaat
ttgcacagttcagacatgaatgggctggtgcagaaggctttggacgcatccaatgtctat
gaaaatatcgccaactatgtcagtgaggccaacgaaacagcagaacttgctctgaatatt
actgatcgaatttatgacgccgtgagtggaattgacactcagatcgtttaccataaggat
gaaagcgacaaccttctcaatcaagccagagagctgcaagcaaaggcggattctagcagt
gacgaggccgtggctgacaccagcaggcgcgtgggaggagccctgtggaggaagggcgcc
ctcagagacaaactgaccgaggctgtcaagcaactccaggcagcagagagaggggatgcc
caccagcgcctgggccagactaagctcatcattgaggaagctaacaagacgacaatggcc
gtccaacaggtcaccacaccgatggctaacaacctcagcaactggtcacagaaccttcag
acttttgactcttctgcctacaacactgcagtgaactccgctcgggacgcagtgagaaac
ctcactgaggttgttcctcggcttctgggtcagctccgtactgtggagcagaagcggcct
gcaagcaatgtttcggccagcatccagagggtccgagagctcatcgctcagaccaggagt
gttgccagcaagatccaggtttccatgctgttcgatggccactcggccgtcgaagttcac
cccaaagtcagtgtggatgacctgaaggccttcacctccatcagcttgtacatgaagcct
cctcccaagccggcggagcccaccggggcctgggtagaagatcagtttgtcctctacctc
ggaagcaaaaccgccaaaaaagagtacatgggtctggcaatcaaaaatgataacctggtc
tacgtttacaatttggggaccaaagatgtggagattctcctggattccaagcccgtgagc
tcctggcctgcttactttagtattgtcaagattgagagggtagggaaacatggaaaggtg
ttcttgacagtccccagtctcagcagcacagcagaagaaaagtttattaagaagggggag
tttgcaggagacgactccttgctggatctgacccctgaggatactgtgttttacgttggc
ggggttcctgcaaacttcaagctcccggccagcttaaacctgcccagctactcaggctgc
ctggagctggccactctgaataatgatgtaatcagcctgtacaacttcaagcacatctac
aacatggacccagctaagtcggtgccctgtgccagggataaactggctttcactcagagc
agggctgccagctacttcttcgatggctccagttacgctgtggtgagggacatcaccagg
agagggaaatttggccaggtgactcgctttgacatagagattcgaacaccagctgacaat
ggcctcgtgctcctgatggtcaatggaagtatgtttttcagcctggaaatgcgcaatggc
tacctgcatgtgttctacgactttggattcagcaacggacccgtgcatcttgaagacaca
ttgaaaaaggcccagatcaacgatgcgaaataccatgagatctcaatcatttaccacaat
gacaagaaaatgattttggtggtggacagacggcatgttaagagcacagacaatgagaag
aagaagataccattcacagacatctacattggaggtgcgccccaagaagtcttacagtcc
aggaccctaagagcacatcttcccctagacatcaactttaggggatgcatgaagggtttc
cagttccaaaagaaagatttcaatttactggagcagaaagaaaccttaggagttggttat
ggatgcccagaggactccctgatctctcgcagagcatatttcaacgggcaaagttttatt
gcttcaactcagaaaatatctttcttcgatggcttcgaaggaggcttcaatttccgaacg
ttacagccaaatgggttactgttctactatgcctctgggtccgacgatgtgttttccatt
tccctggacaatggcactgtcgtcatggatgtaaagggcatcaaggtaaagtcagcagac
aagcagtaccatgatgggctgtcccacttcgtcgtcaccaccgtctcagccacaaggtat
gaactagtagtagacaaaagccgacttgggagtaagaatcctacgaaagggaaggcagag
ccgacgcaaacaaccgagaagaagttctacttcggtggctcgcccatcagccctcagtat
gctaatttcactggatgtataagcaatgcctactttaccaggttggatagagatgtggaa
gttgaagatttccagcggtattctgaaaaggtgcacacttcactctatgagtgtcccatc
gagtcgtcacctctgtttctccttcacaaaaaaggaaagaattcctcaaagcctaaaaca
aacaaacagggagagaaaagtaaggacgcaccttcgtgggatcctattggtctgaagttt
ctggaacggaaagcctcaagagactcccactgccacctctccagcagccccagagcgata
gagcatgcctatcaatatggcggcacggccaacagccgccaagagtttgaacacatacaa
ggagattttggtgaaaaatcccagtttgccattcgtctgaagacccgttcctcacatggg
atgattttctatgtctcagaccaagaagagaatgatttcatgaccctgttcttggcccac
ggtcgcttggtctttatgtttaatgtcggccacaagaaactgaagattagaagccaggag
aagtacagtgatgggttgtggcatgatgtgatatttattcgggaaaagagcagtggccga
ttggtcattgatggtctgcgagtcctcgaagaaaggctcccccctagtgacgctgcctgg
aaaatcaagggtcccatttatctgggaggagtggctcccggaagggctgtgaaaaatgtc
cagattaactcagtctacagtttcagtggctgccttggcaatctccagctcaatggagcc
tccatcgcctctgcctcccaaacgtttagcgtgaccccttgctttgaagggccaatggag
acggggacttatttctccacagaaggaggctatgtggttctagatgagtctttcaacatt
gggctaaagtttgaaatcgcatttgaagtccgtccccggagcagttccgggacccttgtc
catggccacagtgtcaacggggaatacctgaacgtacacatgaaaagcggacaggtcata
gtgaaagtcaacaatggcgtcagagacttttctacctcagtcacccccaagcagaatctc
tgcgatggcagatggcacagaattacagttattagagactccaacgtggttcagttggat
gtagattcagaggtgaaccatgtagttggacccctgaacccaaagccggttgatcacagg
gagcctgtgtttgtcggaggggttccagagtccttgctgacgccccgtttgactcccagc
aaacccttcacaggctgcatccgtcactttgtgatcgatgggcgtccggtgagcttcagt
aaagcagccctggtcagtggtgctgtgagcattaactcctgccccacagcctga

DBGET integrated database retrieval system