KEGG   Rattus norvegicus (rat): 309855
Entry
309855            CDS       T01003                                 

Gene name
Fig4
Definition
(RefSeq) polyphosphoinositide phosphatase
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    309855 (Fig4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    309855 (Fig4)
   05022 Pathways of neurodegeneration - multiple diseases
    309855 (Fig4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     309855 (Fig4)
SSDB
Motif
Pfam: Syja_N
Other DBs
NCBI-GeneID: 309855
NCBI-ProteinID: NP_001040561
RGD: 1311375
Ensembl: ENSRNOG00000000312
UniProt: Q0Z843
Position
20
AA seq 907 aa
MPTAAAPIISSVQKLVLYETRARYFLVGSNHAETKFRVLKIDRTEPKDLVVIDDRHVYTQ
QEVRELLGRLDLGNRTKLSQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIG
GHAIYKIEDTSMIYIPNDSVRITHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLT
VLRMPLEMLKSETSKTCQESFDIFEDEGLTTQGGSGVFGISSEPYMKYVWNGELLDIIKN
SVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVE
TEQILCDASVMSFTAGSYSSYVQVRGSVPLFWSQDISTMMPKPPITLDQADPFAHIAALH
FDQMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHSIVYIPWDMAK
YTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSVLRPDEKWNELGGRVIPTGRLQTG
ILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDT
LSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHP
TEGKPHLWELPTDFYLHHKNTMSLLPPKRSYTHWWTPEVVKHLPLPYDEVICAANLKKLT
VKKFHRWEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTIGIDPSPFTVRKPDE
TGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREDEGSISQRSTPVK
MTDTGDSAKVTESVAQPMKEVYGVSLSRSLSEEDHSIYARFVQLGQSQHRQDWSSPQMCA
RCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDTAIYRE
YIRNRYL
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgcccacggccgctgcccccatcatcagttcggtccagaagctggtgctctatgagact
agagctagatactttctagtcgggagcaatcatgcggaaacaaagttccgagtcctgaag
attgatagaacagaaccaaaggatttggtggtgattgacgataggcacgtgtacacgcaa
caggaagtgcgggaacttcttggccgcctggatctgggaaacagaacaaagctgagccag
aaaggatcctccgggttgtttcgagccgtctccgcgtttggtgtcgtaggttttgtcagg
ttcttagaaggctactatatcgtattaataactaagcggaggaagatggcggatatcgga
ggccatgcaatatataagattgaagatacaagtatgatttatatccccaatgactctgtt
cggattactcaccccgacgaagctaggtacctaaggatattccaaaatgtggatctgtcc
agcaatttttactttagttacagctatgatctgtcccactcccttcagtacaatcttacc
gtcctgcgaatgcccctggagatgttaaagtcggaaacatccaagacctgccaggagagc
ttcgacatctttgaagatgaagggttaactacgcagggcggcagtggcgtatttgggatc
tctagtgagccttacatgaagtatgtctggaacggcgaacttctggatataattaaaaac
agcgtgcatcgcgactggctactgtatatcattcatgggttctgcgggcagtcaaagctt
ctgatctatggacgaccagtgtatgtgaccctaatagccagaagatccagtaggtttgct
gggacgcgctttctcaagagaggtgcaaactgtgagggagatgttgccaacgaggtggag
acggagcagatcctctgtgatgcctcggtgatgtcttttaccgcaggcagttactcttct
tacgtacaagtcagaggctctgttcccttattctggtcccaagacatctcaaccatgatg
ccgaaaccacccattacactggaccaggcagatcccttcgcacacatagccgctcttcac
tttgaccagatgctgcagaggtttggctcccccatcatcatcctgaacttagtgaaggag
agagagaagagaaagcacgaaaggattctgagcgaggagctggtggccgcggttacttac
cttaaccagttcctgcccccggagcacagcattgtatacattccctgggatatggccaag
tacaccaagagtaagctgtgtaacgttctcgatcgtctgaacgtgattgcagaaagcgtg
gtaaagaagacaggcttcttcgtcaaccgccctgattcttactgcagcgttttacggcca
gatgagaagtggaacgaactaggaggtcgtgtgattcccactggtcggctccagaccggc
atccttcgaaccaactgcgtggactgtttggatcgtaccaacacggcgcagttcatggtg
ggcaagtgcgccctggcttaccagctgtactccttagggctgattgacaagcccaacctg
cagttcgatacggacgcagtgaggttatttgaggaactctatgaagaccatggagacacc
ctttccctgcagtacggaggctctcagctggttcatcgggtgaagacctacagaaagata
gcgccgtggacccagcactccaaggacatcatgcagacgctgtctcggtactacagcaat
gccttttcagatgcggacagacaagattccatcaacctgttcttgggtgttttccacccc
acagaagggaaacctcatctctgggaacttcccacggacttttacctgcatcacaaaaac
accatgagccttttaccccccaaaaggagttatactcactggtggacaccagaggtggtg
aagcatttgccgctgccttacgacgaagttatctgtgctgcaaacttaaagaagttgacg
gtgaagaagtttcacagatgggaagaggagattgatattcacaatgagttcttccggccg
tatgaattgagtagttttgatgacaccttttgcctggccatgacaagttcagcacgtgat
tttatgcctaaaactattggcattgacccaagtccattcaccgtgcgaaaaccagacgaa
accgggaaatctgtactggggaacaaaagcaacagagaggaggccgtcctgcaacggaaa
acggcagccagcgccccgccaccccccagcgaggaggccgtgtccagcagctccgaggac
gactctggtactgaccgggaagacgaaggttccatctcgcagcgatccactcctgtgaag
atgactgacaccggagacagcgccaaagtgactgagagtgtggcccaacccatgaaggaa
gtgtacggagttagcctctcacgtagcctgtccgaggaggatcactccatttatgccagg
tttgttcaactggggcagagtcagcatagacaggactggagcagcccgcagatgtgtgcc
cggtgctcagacggagttatcaaactaacccccatctcagctttctcgcaagacaacatt
tatgaagttcagcccccgagagtagacagaaagtccacagagatcttccaggcccacatc
caggccagccaaggtatcatgcagccccttggcaaagaggacactgccatataccgggag
tacatcagaaaccgctacttataa

DBGET integrated database retrieval system