KEGG   Rattus norvegicus (rat): 309858
Entry
309858            CDS       T01003                                 

Gene name
Sec63
Definition
(RefSeq) translocation protein SEC63 homolog
  KO
K09540  translocation protein SEC63
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    309858 (Sec63)
   04141 Protein processing in endoplasmic reticulum
    309858 (Sec63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    309858 (Sec63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    309858 (Sec63)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   309858 (Sec63)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   309858 (Sec63)
SSDB
Motif
Pfam: DnaJ Sec63
Other DBs
NCBI-GeneID: 309858
NCBI-ProteinID: NP_001101107
RGD: 1304984
Ensembl: ENSRNOG00000000314
UniProt: D4A2Z6
Position
20
AA seq 727 aa
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNVLIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIIMARSREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKFKIKSIQDLVSLKEADR
HSLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQSDANKNKAKGGWQQKNKGPKKMPKSKKKKPLKKKPTTVP
LPQGKQQKQKQANGVVGSEAAMKEEEEDISDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQSKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEVELKFPAPGRPGNHQ
YTVFLRSDSYMGLDQTKPLKLEVHEAKPVPENHPQWDTAIEGDEDQEDSEGFEDSFEEEE
EEEEGGD
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcgggccagcagttccagtacgatgacagcgggaacaccttcttctacttcctcacc
tccttcgtggggctcatcgtgatccccgccacctactacctctggccgcgagaccagaat
gcggagcaaattcgattaaagaatatcagaaaagtatacggaagatgtatgtggtatcgt
ttacggttattaaaaccccagccaaatattattcctacagtaaagaaaatagttctgctt
gcaggatgggcattgttcttatttcttgcctacaaagtttccaaaacagaccgagaatat
caagagtacaatccttatgaagtattaaatttggatcctggagcaacagtagcagaaatt
aagaaacaatatcgcttgttgtcacttaaatatcatccagataaaggaggtgatgaagtc
atgttcatgaggatagcgaaagcttacgcagctttaacagatgaagagtctcggaaaaat
tgggaagaatttggaaatccagatgggcctcaagccacaagctttggaattgctttgcca
gcttggatagttgaccagaaaaattcgattctggttttacttgtgtatggattggctttt
atggttatccttcctgttgttgtgggctcttggtggtatcggtccatacgatatagcgga
gaccagattctaatccgtacaacacagatttatacatactttgtttataagactcggaat
atggatatgaagcgtctcatcatggttttagctggagcttctgaatttgatcctcaatat
aataaagatgccacaagcaggccaacagataatgttttaatacctcagctaatcagggaa
attggcagcataaatttaaagaagaatgaacctccacttacctgtccatatagcctgaag
gccagagttcttttactgtctcatcttgctagaatgaaaattcctgagacactggaagaa
gatcaacagttcatgctgaaaaagtgtcctgctctgcttcaggaaatggtgaatgtaatc
tgccagctgataataatggcccggagccgtgaagaaagggagtttcgtgctccaactttg
gcatccttagaaaactgcatgaagctttcccagatggctgttcaggggctgcagcagttc
aagtctccccttctgcagctccctcacatcgaagaagacaatcttagaagagtttcaaac
cacaaaaagttcaaaattaaaagtatccaggatttggtcagtttaaaagaagcagatcgt
catagtctgctacacttccttgaagatgaaaagtatgaagaggtcatggcagttcttggg
agtttcccgtatgtgaccatggacataaaatcacaggtgttggatgatgaagacagcaac
aacatcacagtagggtccctggtcacagtgctggttaaactgacgaggcagacgatggct
gaagtgtttgaaaaggagcagtccatctgcgctgctgaggaacagcccgcagaagacggg
cagagtgatgccaacaagaacaaggcaaaaggaggatggcagcagaagaacaaaggaccc
aagaaaatgcccaaatccaaaaaaaagaagcctttaaaaaaaaaacccacaactgtgccc
ttacctcagggaaagcagcagaagcaaaagcaggcaaatggagttgttgggagtgaagct
gcaatgaaggaggaggaggaggacatttctgacaaaggcagcgactctgaagaggaggag
accaatagagactcgcagagcgagaaggacgatggcagtgacagagactctgacagagag
caggatgagaagcaaagcaaagacgacgaagcagagtggcaagagctacagcaaagtata
cagaggaaggagagagctcttttggagaccaagtcgaagataacacaccctgtgtatagt
ctttactttcccgaggtagagctgaagttccctgcacctggcaggcctgggaatcaccag
tacacagtgtttctgcggtcggactcctacatgggcctggaccagactaaaccactgaag
ttggaagttcatgaggccaagcccgtgccagaaaaccacccacagtgggacacagcaata
gaaggtgacgaagaccaggaagacagtgaaggatttgaagacagctttgaggaagaggag
gaggaagaggagggtggtgactaa

DBGET integrated database retrieval system