KEGG   Rattus norvegicus (rat): 309860Help
Entry
309860            CDS       T01003                                 

Gene name
Sobp, RGD1560479, Sobpl, jcx1
Definition
(RefSeq) sine oculis binding protein homolog
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SOBP zf-FCS zf-C6H2
Motif
Other DBs
NCBI-GeneID: 309860
NCBI-ProteinID: NP_001098110
RGD: 1560479
Ensembl: ENSRNOG00000000316
UniProt: A7XYI6
Position
20q13
AA seq 864 aa AA seqDB search
MAEMEKEGRPPENKRSRKPAHPVKREINEEMKNFAENTMNELLGWYGYDKVELKDGEDIE
FRSYTTDGESRQHISVLKENSLPKPKLPEDSVISSYNISTGYSGLATGNGLSDSPAGSKD
HGNVPIIVPLIPPPFIKPPAEDEVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFA
ACRRAYFKRNKARDEDGHAESFPQQHYAKETPRLAFKNNCELLVCDWCKHIRHTKEYLDF
GDGERRLQFCSAKCLNQYKMDIFYKETQANLPAGLCGTLHPHMESKAEGTGVQLLTPDSW
NIPLTDARRKAPSPVAAAGQSQGPGPSSSTTVSPSDTANCSVTKIPTPVPKSLPISETPS
IPPVSVQPPASIGPPLGVPPRSPPMVMTNRGPVPLPIFMEQQIIQQIRPPFIRGPPHHAS
NPNSPLSNPMLPGIGPPPGGPRNLGPTSSPMHRPMLSPHIHPPSTPTMPGNPPGLLPPPP
PGAPLPSLPFPPVSMMPNGPMPVPQMMNFGLPSLAPLVPPPTLLVPYPVIVPLPVPIPIP
IPIPHVNDSKPPNGFSSNGESFVPSAPGDSSAAGGKAGGRSLSPRDSKQGSSKSADSPPG
SSGQALSLAPSERGRGEVVDLTRRAASPAGAGGQPGFAGVLHGPQDGVIDLTVGHRARLH
NVIHRALHAHVKAEREPGAAERRTCGGCRDGHCSPPAAGDPGPGAPAGPEAAAACNVIVN
GTRSAPAEAKGAEPPPEQPPPPAPPKKLLSPEEPAVNELESVKENNCASNCHLDGEVTKK
LMGEEALAGGDKSDPNLNNPADEDHAYALRMLPKTGCVIQPVPKPAEKAAMTPCVISSPM
LSAGPEDLEPPLKRRCLRIRNQNK
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatggagaaagaagggagacctccggaaaataaaaggagccggaaaccagct
caccctgtgaagagggaaatcaacgaggagatgaagaactttgcagaaaacaccatgaat
gaactcctcggctggtatggctatgataaagttgaattaaaagacggcgaagatattgaa
ttcagaagctacactactgatggagaaagccggcaacacatttctgttctcaaagaaaac
tctttgccaaaaccaaaattaccggaggacagtgttatttcatcttacaatataagcaca
ggctactcaggccttgccactgggaacggactcagtgactcgcctgcagggtcaaaggac
catggcaatgtgcctattattgtccctttaatcccaccacctttcataaagccgccagca
gaagatgaggtgtcaaatgtacaaataatgtgtgcctggtgccagaaagtggggatcaag
cgctattccctgagtatgggaagtgaggtgaaaagcttctgcagcgagaaatgctttgcg
gcctgccggagagcctacttcaaaagaaacaaggctagagatgaagatggacatgctgaa
agttttccccagcagcactatgctaaggaaactccaaggcttgccttcaagaataactgc
gaactacttgtgtgtgactggtgtaaacacataaggcatacaaaagaatacctggatttt
ggggacggggagagaaggcttcagttctgcagtgcaaaatgtctcaatcaatacaaaatg
gacattttctacaaagagacacaggccaaccttccagctgggctgtgcggcacgttacac
cctcacatggagagcaaagcagaaggcaccggggtgcagctgctcactccagactcttgg
aatatcccgctaacagatgctcggaggaaagccccctcccccgtggctgcagctggccaa
agccagggccctggcccctcctcgtccaccaccgtttctccatctgacactgccaactgc
tctgtcactaaaatccccacgccagtgcccaagtccctccccatcagcgagactccaagc
atccctcccgtctcagtccagccacctgctagcatcggacctccactgggtgtcccgcct
cgcagtcctcccatggtgatgaccaaccgcggcccagtgcctctgcccatcttcatggag
cagcagatcatccagcagatccgcccgcccttcatccgtggcccaccgcaccacgcctcc
aaccccaatagccccttgtccaaccccatgctcccgggcattgggcccccgcccggtggc
cccaggaacctaggccccacttccagtcccatgcacaggcccatgctctcgccccacatc
caccccccaagtacccctaccatgcctgggaaccccccagggctgctgcccccgccgccc
ccgggcgcgcccttgcccagccttcccttccctccggtaagcatgatgccaaacggcccg
atgccggttccccagatgatgaacttcgggctgccatcgctggccccgctggtgccgccc
ccaacgctgctcgtgccgtacccagttatcgtgcccctgccggtgcccatccctatccct
atccctatcccccacgtgaacgattccaagccccccaacggattttccagcaacggggag
agcttcgttccgagcgccccgggcgactcctcggcggcgggaggcaaggctggtggacgc
tccttgtccccgcgggactccaagcagggctcttccaagtcagccgactcgccgcccgga
agctccggccaggctctgagcctggcgccctcggagcgcggtcgcggggaggtggtggac
ctgacccggcgcgcggccagccccgcgggcgcgggaggccagccgggcttcgcgggcgtg
ctgcacggcccgcaggacggcgtcatcgacctgaccgtgggccaccgagcccggctgcac
aacgtgatccaccgcgcgctgcacgctcacgtcaaggcggagcgcgagccgggagccgcg
gagcgcaggacctgcggcggctgcagggacggccactgcagcccgcccgccgccggcgac
cccggcccgggcgcccccgcgggtccggaggccgccgccgcctgcaacgtcatcgtgaac
ggcacccgcagcgctcccgcggaggccaagggcgcggagcccccgcccgagcagccgccg
ccccctgcccctcccaaaaagctgctgtcgcccgaggagcccgcggtgaatgagctggag
tcggtcaaggagaacaactgcgcttccaactgccacctggacggggaagtcaccaaaaaa
ctgatgggggaggaagccttggcggggggcgacaagtcagacccgaaccttaataacccc
gcggacgaggaccacgcctatgctctgcggatgctgcccaagaccggctgcgtgatccag
cctgtgccaaaacccgcagagaaggctgccatgacgccgtgcgtcatctcctcgcccatg
ctcagcgctggccccgaggacctggagccgccgctcaaaaggaggtgcctccgaattaga
aaccagaataagtaa

DBGET integrated database retrieval system