KEGG   Rattus norvegicus (rat): 309871Help
Entry
309871            CDS       T01003                                 

Gene name
Prdm1
Definition
(RefSeq) PR/SET domain 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 SET zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 309871
NCBI-ProteinID: NP_001101109
RGD: 1311765
Ensembl: ENSRNOG00000000323
Vega: OTTRNOG00000000856
UniProt: D4A1S2
Position
20q13
AA seq 824 aa AA seqDB search
MLDLLLEKRVGTTLAAPKCNSGSVKFQGLAETSGIMKMDMEDADMTLWTEAEFEEKCTYI
VNDHPWDSSADGGTSVQAEASLPRNLLFKYAANNSKEVIGVVSKEYIPKGTRFGPLIGEV
YTNDTVPKNANRKYFWRIYSREEFHHFIDGFNEEKSNWMRYVNPAHSAREQNLAACQNGM
NIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTVMNLTQTESNPKQYSSEKNELYP
KSVPKREYSVKEILKLDSNPSKRKDSYRSNISPYTSEKDMDGFRKNGSPDMPFYPRVVYP
IRAPLPEDFLKASLAYGMERPTYITHSPLPSSTTPSPPASSSPEQSLKSASPHGSPGNTV
SPVVPGPPEHRDSYSYLNVSYGSEGLGSYPGYAPAPHLPPAFIPSYNAHYPKFLLPPYGI
SSNGLSTMNNINGINNFSLFPRLYPVYSNLLSGGNLPHPMLNPASLPSSLPTDGARRLLP
PEHPREVLVPAPHSAFSLTGAAASMKDESSPPSGSPTAGTAATSEHVVQPKATSSVMAAP
STDGAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGER
PFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQC
KVCPAKFTQFVHLKLHKRLHTRDRPHKCAQCHKSYIHLCSLKVHLKGNCPVVPAPGLPLE
DLTRINEEIERFDLSDNADRLEDMEDSVDVTSMVEKEILAIVRKEKEETGLKMSLQKTMG
SRLPSSGCSLYESSDLSLMKLPHSNSLPLVPVKVKQETVEPMDP
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcttctcttggaaaagcgtgtgggtacgaccttggctgcccccaagtgtaac
tccggttccgtgaagtttcaaggattggcagagacgtctgggatcatgaaaatggacatg
gaggacgcggatatgactctgtggacagaggccgagtttgaagagaagtgtacgtacata
gtgaacgaccacccctgggattccagcgccgacgggggtacttctgttcaagccgaggca
tccttaccaaggaacctgctcttcaagtatgccgccaacaacagcaaagaggttattggt
gtggtgagtaaggaatacatcccaaagggaacgaggttcggacccctgatcggcgaagtc
tacaccaacgacacggttcccaagaatgccaacaggaaatatttttggcggatctattcc
agagaggagttccaccacttcatcgacggctttaacgaggagaaaagcaactggatgcga
tacgtgaatccagctcactctgcccgggagcagaacctggccgcctgccagaacggaatg
aacatctatttctacactattaagcctatccctgccaaccaggaacttcttgtgtggtat
tgccgggactttgcggagaggctccactacccttatcctggagagctcacagtgatgaat
ctcacacaaacagaaagcaacccaaagcaatacagcagtgagaaaaatgaactctaccca
aagagtgtccccaagagagagtacagcgtgaaagaaatcctcaaactggactccaatccc
tccaaaaggaaggacagctaccgttccaacatttcaccctacacttcagaaaaagacatg
gatggctttcggaaaaatgggagcccggacatgcccttctaccctcgggttgtgtatccc
atccgggcacctctgccagaagactttttgaaggcgtccctggcctatgggatggagaga
cccacctacatcactcacagcccccttccgtcttccacaactccaagtccccctgcaagc
agtagcccagagcagagcctcaagagcgccagcccccacggcagcccggggaacacggtg
tcacccgtggtgccaggccccccagagcaccgggactcctactcctacttgaatgtttcc
tatggttctgagggcctgggctcctaccctggctatgcccctgccccgcatctcccgccg
gctttcatcccctcctacaatgctcactaccccaagttcctgttgccaccctacggcatc
agctccaatggcttgagcactatgaacaatatcaatggtatcaacaacttcagcctattc
cccaggttgtatcctgtctacagtaacctcctcagtgggggcaacctgcctcaccccatg
ctcaacccagcttccctaccgagttccctgcctaccgatggagcccggaggctgctccca
ccggagcaccccagagaggtgcttgtcccggcgccccacagtgccttctcccttactggg
gctgcagccagcatgaaggacgagagtagcccccccagcgggtctccaacggcgggaact
gcggccacgtcggaacacgtggtacaacccaaagctacctcatcggtgatggcagccccc
agcactgacggagccatgaatctcattaagaacaaaagaaacatgactggttacaagacc
cttccttacccgctgaagaagcagaacggcaagatcaagtatgagtgcaatgtctgtgcc
aagacgtttggtcagctctcaaacctgaaggtccacctgagagtgcacagtggagaacgg
cctttcaaatgccagacctgcaacaagggctttactcagctcgcccacctgcagaaacac
tacctggtacacacgggagaaaagccacatgaatgccaggtctgccacaagagatttagt
agcacaagcaatctcaagacacaccttcgactgcattctggagaaaaaccttaccagtgt
aaggtgtgccctgccaagtttacacagttcgtgcacctgaagctgcacaagcgactgcac
acccgggatcggcctcacaagtgtgcccagtgccataagagctacatccatctctgtagc
ctcaaggtccacctgaagggcaactgccctgtggtcccagcccccgggctgcccttggag
gacctgacccggatcaatgaagaaatcgagaggttcgaccttagcgacaacgctgaccgt
cttgaggacatggaggacagcgtcgatgtgacctccatggtggagaaggagattctagcc
atagtcaggaaagagaaagaagaaactggtctgaaaatgtctttgcaaaaaaccatgggg
agcagactcccctcctcagggtgcagcctctacgagtcatcagacctgtccctcatgaag
ttgcctcacagcaactcactacctctggtgcctgtaaaggtcaaacaagaaacagttgaa
ccgatggatccttaa

DBGET integrated database retrieval system