KEGG   Rattus norvegicus (rat): 309945Help
Entry
309945            CDS       T01003                                 

Gene name
Arrdc3, LRRGT00048
Definition
(RefSeq) arrestin domain containing 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C Vps26
Motif
Other DBs
NCBI-GeneID: 309945
NCBI-ProteinID: NP_001007798
RGD: 1359478
Ensembl: ENSRNOG00000045649
UniProt: Q6TXF1
Position
2q11
AA seq 414 aa AA seqDB search
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNCEEGFSTIHSGRHEYAFSFELPQ
TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKM
KEVKQLVANLRGESLSSGKTETWDGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LLLSLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLGLSLPERPEAPPSYAEVVTEEQRRN
NLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSSEDRPSCPSR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggaaaggtaaagagtttgacaataagctttgactgtcttaatgacagtaat
gtccccgtgtattctagcggggacactgtctcaggaagggtaaatttagaagttactggg
gaaatcagagtaaaatctcttaaaattcatgcaagaggacatgcgaaagtacgctggact
gaatcaagaaacgccggctccaatactgcctatacacagaattacactgaagaagtagaa
tatttcaaccataaagacatcttaattgggcacgaaagagatgatgataattgtgaagaa
ggcttcagcactattcattcaggacggcatgaatatgcatttagcttcgagcttccacag
acaccacttgctacctcatttgaaggccgacatggcagtgtgcgctattgggtgaaggcc
gaattgcataggccttggcttctaccagtaaaattaaagaaggaatttacagtctttgag
cacatagatatcaacactccttcattactgtcaccccaagcaggcacaaaagaaaagaca
ctctgttgctggttctgcacctcaggcccaatatccttaagtgccaaaattgagaggaag
ggctacaccccaggtgaatcaatacagatatttgctgagattgagaactgctcttcccga
atggtagtgccaaaggcagccatttaccaaacgcaggccttctacgccaaagggaaaatg
aaggaagtaaaacagctggtggcaaacttacgtggggaatccttatcatctgggaagacg
gagacgtgggacggcaagctgctcaagatcccaccagtttcaccctccatcctcgactgt
agtataatccgtgtggagtattcgctaatggtatacgtggatattcccggggccatggat
ttgcttctcagtttgccactagtcattgggaccatccctctacatccatttgggagcaga
acctcaagtgtgagcagtcagtgtagcatgaatatgaactggctcggtctatcccttcct
gaaagacctgaagcaccacccagttatgcagaggttgtaacggaggaacagagacggaat
aatcttgcaccagtgagtgcttgtgatgattttgagagagctcttcaaggaccactgttc
gcatatatccaggagttccggttcctgcctccacctctctattcagagattgatccaaat
cctgatcagtcatccgaggacagaccatcatgcccctctcgctga

DBGET integrated database retrieval system