KEGG   Rattus norvegicus (rat): 309957Help
Entry
309957            CDS       T01003                                 

Gene name
Mef2a
Definition
(RefSeq) myocyte enhancer factor 2a
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04371  Apelin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    309957 (Mef2a)
   04022 cGMP-PKG signaling pathway
    309957 (Mef2a)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    309957 (Mef2a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    309957 (Mef2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    309957 (Mef2a)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    309957 (Mef2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF HJURP_C GHD
Motif
Other DBs
NCBI-GeneID: 309957
NCBI-ProteinID: NP_001014057
RGD: 1359360
Ensembl: ENSRNOG00000047756
UniProt: Q2MJT0 A0A0G2JSZ4
Position
1q22
AA seq 495 aa AA seqDB search
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLAESSML
SPPPATLHRNVSPGAPQRPPSTGSAGGMLSTTDLTVPNGAGNSPVGNGFVNSRASPNLIG
NTGANSVGKVMPTKSPPPPGGGSVGMNSRKPDLRVVIPPSSKGMMPPLNAQRISSSQATQ
PLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFTSPGMLSLGQASAWQ
QHHLGQAALSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQQQQQQQPQ
QQPPPQPPQPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNAEDR
ESPSVKRMRMDTWVT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaaagaaaatacaaattacacgcataatggatgagaggaaccgacaggtgact
tttacaaagcgaaagttcggattgatgaagaaagcctatgaactcagtgtgctctgtgac
tgtgagatagcactcatcatcttcaacagctctaacaagttgtttcagtacgccagcact
gacatggacaaagtccttctcaagtacaccgagtacaacgagcctcatgaaagcaggacg
aactcggatattgtggaggctctgaacaagaaggaacacagaggctgcgacagcccagac
cctgatacttcatatgtgctaactccacatacagaagaaaaatataaaaaaattaatgag
gaatttgataatatgatgcggaatcataaaatcgcacctggcttgccgcctcagaacttc
tcaatgtctgtcacagtccctgtgaccagccctaatgctttgtcgtacactaacccaggg
agttcactcgtgtcaccgtctttggcagccagctcaacattagcagagtccagcatgctg
tctccacccccagccacgctacatagaaatgtgtctccaggagctccgcagagaccacca
agcactggcagtgcaggtgggatgttgagcactacagacctcacggtaccaaatggagct
ggaaatagtcctgtggggaatggatttgtaaactcaagggcctctccaaatttgattgga
aatactggtgcgaatagtgtaggcaaagtcatgcctacaaagtcccccccgccaccaggt
gggggcagtgttggaatgaacagtcggaaaccagatctacgggttgtcattcccccttca
agcaagggcatgatgcccccacttaatgcccaaaggataagtagttctcaagccacacaa
cctcttgccacgcccgtggtgtctgtgacaactccaagcttgcctccgcagggactagtg
tactcggccatgccgacagcctacaacactgattactcattgaccagcgctgacctgtcc
gccctgcaaggctttacttcccctggaatgctgtctctggggcaggcttcagcctggcag
cagcaccatctaggacaagcggccctcagctctctagtggctggagggcagttatctcag
ggttcaaatttgtccattaacaccaaccagaacatcaacattaagtcagagccaatttca
cctccccgtgatagaatgaccccatcaggcttccagcagcagcagcagcagcagccacag
cagcaaccaccgccacaacctccacagccccagccccaaccccggcaggaaatggggcgc
tcccctgtggacagtctgagcagctctagcagctcctacgatggcagtgaccgggaggat
ccacggggcgacttccattctccaattgtgcttggccgacctccaaatgctgaggacaga
gaaagcccctctgtaaaacgcatgaggatggacacatgggtgacctaa

DBGET integrated database retrieval system