KEGG   Rattus norvegicus (rat): 309969
Entry
309969            CDS       T01003                                 

Gene name
Ap3b1
Definition
(RefSeq) adaptor-related protein complex 3, beta 1 subunit
  KO
K12397  AP-3 complex subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    309969 (Ap3b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    309969 (Ap3b1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    309969 (Ap3b1)
 Endosome - Golgi transport
    309969 (Ap3b1)
SSDB
Motif
Pfam: Adaptin_N AP3B1_C SEEEED Cnd1 BUD22
Other DBs
NCBI-GeneID: 309969
NCBI-ProteinID: NP_001101116
RGD: 1310256
Ensembl: ENSRNOG00000010624
UniProt: D3ZIF5
Position
2q12
AA seq 794 aa
MAVAQLYWHISPRSEAGVISKSLVRLLRSHREVQYIVLQNIATMSIQRKGMFEPYLKSFY
VRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVRSQDKQFAAATIQTIGRCATSIA
EVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEIIKHMAKLLDSITVPVAR
ASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLGAKLYLTNSKQTKLLTQ
YILNLGKYDQNYDIRDRTRFIRQLIVPNEKSGALSKYAKKIFLAQKPAPLLESPFKDRDH
FQLGTLSHTLNVKASGYLELSNWPEVAPDPSVRNVEVIESAKEWTPLGKTKKEKPEKKFY
SESEEEEEEEEEDEEDEEEDPSDSSSDSESGSGRESGDSGSSSEDSSEDSSSGQDSETGS
EAEAEHQRVAKTNSKTKRKSASEDREKKNGKSQASESSSEESSSTEESSSESESGSDSEP
APRKTAKAKERKPQQERHPPSKDVFLLDLDDFNPVSTPVALPTPALSPSLIADLEGLNLS
TSSSIINVSTPVFVPTKTHELLHRMRGKGLAAHYCFPRQPCIFGDKMVSVQITLTNTSDG
KIENIHVGGKKLAVGVQMHVFHPIESLEPEGSVTVSMGIDFCDSTQTASFQLCTKDDCFN
VNIQPPVGELLLPVAMSEKDFKKEQGMLTGMNETSATLIAAPQNFTPSMILQKVVNVANL
GAVPSSQDNIHRYERLKFQVLQERFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIG
SVLLRELKPVLSQG
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggctgtcgctcagctgtactggcacatctcacccaggtcggaggctggtgtcatttct
aaatcgctggtgcgcctacttcgcagccatagggaggtgcagtatattgtattgcaaaat
atcgcaactatgtcaattcagagaaagggtatgtttgaaccttacctgaagagcttctat
gtccggtccactgatccaactatgatcaagactctgaagcttgaaatcttgacaaacttg
gcaaatgaagccaacatatcaactcttcttcgagaatttcagacctacgtgagaagccag
gacaaacagtttgcagcggccactattcagaccataggcagatgtgcaaccagcattgcc
gaggtcactgacacatgcctcaatggcctggtctgcctgctgtccaacagggatgaaata
gttgttgctgaaagtgtggttgttataaagaaattgttgcaaatgcagcctgcacagcat
ggtgagattattaagcacatggcgaagctgttggacagcatcactgtccctgtggctcga
gcaagcattctttggctgattggagaaaactgtgaacgcgttcctaaaattgctcctgat
gttttgagaaaaatggctaaaagtttcactagtgaagatgatctggtgaaactgcagatt
ttaaatcttggagcaaaattgtatttaactaattccaaacagacaaaattgcttacccag
tacatattaaatctcggcaagtatgatcagaactacgacatcagagaccgcacaagattt
attaggcagcttattgttccgaacgagaagagtggagctctaagtaaatatgccaaaaaa
atctttctagcacagaagcctgcaccactgctggagtctccctttaaagacagggatcat
ttccagcttggcaccttatctcatactctcaacgttaaagcgtccgggtacctggaatta
tctaattggccagaggtggcgcctgacccatcggttcgcaatgtagaagtaatagagtca
gcaaaagagtggaccccacttggaaaaacaaagaaagaaaaacctgagaagaaattttat
tcagaatctgaggaggaggaggaggaagaagaggaagatgaagaagatgaggaggaggat
ccctctgatagcagcagtgacagtgagagtgggtctggacgtgagagtggagactcaggc
agcagcagcgaggacagcagcgaggactcctccagtggacaagacagcgagaccggaagc
gaggcagaagcagaacaccagagggtggccaagacgaactccaaaaccaagaggaaaagt
gcctcagaagacagggagaagaaaaatggaaaatctcaggcctcggagtcgtccagtgag
gagtccagttccacagaagaaagttcttcagagtcagagtcaggctctgacagtgagcct
gcacccagaaaaacagctaaggcaaaagaaagaaaaccccagcaagaaagacatcctccc
tccaaagatgttttccttctcgatctggatgactttaacccagtatccaccccagttgcc
cttcctacaccagccctttctccaagcttgatagctgatcttgaaggtctaaacctgtca
acttcctcatccatcatcaacgtcagtacacctgtcttcgtgcccacaaaaacacatgag
ctgcttcaccgcatgcgtgggaaaggactggctgcccactactgcttcccaagacagcct
tgcatcttcggtgacaagatggtctctgtacagataaccctgaccaatacttccgatggg
aagatagagaacatccacgtaggcgggaagaagcttgctgtgggcgtgcagatgcacgtc
ttccatcccatagagtctctggagcctgagggatccgttactgtctcgatgggtattgac
ttctgtgattctacacagacggccagttttcagctgtgcaccaaggatgattgcttcaac
gtcaacatccagccacctgttggggagctgcttttacctgtggccatgtcagagaaagac
tttaagaaggagcaagggatgctcactgggatgaatgagacgtcggcaacgctcatcgcc
gctccgcagaacttcaccccctccatgatcctccagaaggttgtaaacgtcgccaacctc
ggtgcagtgccttccagccaagataacatacacagatatgagagattaaaattccaagtt
cttcaagaaaggtttgcagctaaaactgtgcacagtgggtcactgatgctagtcaccgtg
gaactgaaggaaggttccacagcccaacttatcatcaacaccgagaaaaccgtgattggc
tctgtgctgctgagggagctgaagcctgtcctgtcccaggggtaa

DBGET integrated database retrieval system