KEGG   Rattus norvegicus (rat): 309995
Entry
309995            CDS       T01003                                 

Gene name
Xrcc4
Definition
(RefSeq) X-ray repair cross complementing 4
  KO
K10886  DNA-repair protein XRCC4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    309995 (Xrcc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    309995 (Xrcc4)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     309995 (Xrcc4)
SSDB
Motif
Pfam: XRCC4 TMF_DNA_bd Rootletin PAXX ZapB Phage_HK97_TLTM
Other DBs
NCBI-GeneID: 309995
NCBI-ProteinID: NP_001007000
RGD: 1359573
Ensembl: ENSRNOG00000029966
UniProt: Q5XI44
Position
2q12
AA seq 323 aa
MERKVSRISLASEPNVTYFLQVSWEGTIGSGFVITLTDGHSAWTAKVSESEIAQEADDMA
MEQEKYMDELRRALVPESGAAGAYKFIFSKDTQHFSLEKELKDVSFRLGSFNLDKVTNPT
EVIRELICYCLDTIAEKQAKNEHLQKENERLLRDWTDVQGRFEKCVSDKEALEADLYQRF
ILVLNEKKTKIRSLLSEVQQLEKSTKPERETPSSDKIPEEDGLYDGSTDEESGAPVLGAD
TLDKDDSLFSSPDVTDIAPSRKRRHRMQTNLGTEPKMAPQELPLQEKERLGSSPPQTLKE
EGTSAAKMSLETLRNSSPEDLFD
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaaaggaaagtcagcagaatctctctggcttctgaacccaatgtaacctactttcta
caagtgtcttgggaggggacgataggatctggttttgttattacacttacggatggccat
tcagcctggactgcaaaagtttctgaatcggagattgcacaggaagctgatgacatggct
atggagcaggaaaaatacatggatgagctgagacgggcactggtgccagagtcgggagca
gctggtgcatacaagttcatcttttccaaggacactcagcatttctccctggagaaagaa
ctgaaagatgtttctttcagacttggttccttcaacctagacaaagttacaaacccaact
gaagtcatcagagaactcatttgctactgcctggacaccattgcggaaaaacaagccaaa
aacgagcacctgcagaaggaaaacgaaaggctcctgagagattggactgacgttcaaggc
cgatttgagaaatgtgtgagtgacaaagaagccttggaggccgatttgtatcaaagattt
atcttggtgctgaatgagaagaaaacaaaaatccgaagcttgttgagtgaagtccagcag
ctggagaagagtaccaaacctgaaagggaaactccgagttctgacaaaatacctgaggag
gatgggctttatgatggcagcactgatgaagaaagcggagcccctgtgctgggcgcagat
acccttgataaggatgattccttattttcaagtccagatgtcactgatattgcaccaagt
aggaagaggagacaccgaatgcagacaaatcttgggacagaacctaaaatggctccacag
gagctgccactacaggagaaggaaaggcttggctcttcaccgcctcagaccttgaaagag
gagggcacctctgctgcaaagatgtccttagaaaccctgagaaacagcagcccagaagac
ctctttgactag

DBGET integrated database retrieval system