KEGG   Rattus norvegicus (rat): 310097Help
Entry
310097            CDS       T01003                                 

Gene name
Snx18, Snag1
Definition
(RefSeq) sorting nexin 18
  KO
K17923  sorting nexin-9/18/33
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310097 (Snx18)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    310097 (Snx18)
  Macropinocytosis
   Sorting nexins
    310097 (Snx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3_WASP_bdg PX SH3_9 SH3_2 SH3_1 Vps5 BAR
Motif
Other DBs
NCBI-GeneID: 310097
NCBI-ProteinID: NP_001101122
RGD: 1310367
Ensembl: ENSRNOG00000010971
UniProt: D3ZZ38
Position
2q14
AA seq 615 aa AA seqDB search
MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGLFPASYVQVIR
APEPGPPADGGPGAPARYANVPPGGFEPLPAAPPAAFQPLLQPQASPGSFQSPGAGFTYG
GGAPQPSPQQLYGAYQASLGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGGGA
AGRYRLSTRSDLSLGSRGVSAPPPHQASGAKSSATVSRNLNRFSTFVKSGGEAFVLGEAS
GFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPV
HRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVL
AQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKID
GFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGL
NQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKES
RRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQK
VTQKLEEALHKYDSV
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcgctacgcgcccgggcgctctacgactttaggtccgagaaccccggtgagatctcc
ctgcgggagcacgaggtgttgagcttgtgcagcgagcaggacatcgagggctggcttgaa
gggatcaacagccgcggcgaccgcggcctcttcccggcttcgtacgtgcaggttatccgt
gcgccggagcctggccctccggccgacggcggcccaggagctccggcccgctacgccaac
gtgccgcccggcggcttcgagcctctgccagccgcgccgcccgctgccttccagccgctg
ctgcagccgcaggcgtcgcccggttccttccagtcgccgggcgccggctttacctacggc
gggggcgccccgcagccgtcgccccagcagctctacggtgcttaccaggccagcctaggc
agcgacgatgactgggacgacgagtgggacgacagctccacagtggcagacgagccaggc
gcgttgggcagcggtgcgtacccggacctcgacggttcgtcctcagcgggcggcggcgcg
gccggccgctaccgcttgtccacacgctcggacctgtcgctgggctcccgtggcgtctca
gcgcccccgccgcatcaagcgtctggagccaagagctccgccacggtgagccgcaacctc
aatcggttctccaccttcgtcaagtcgggcggggaggcgttcgtgctgggagaggcgtca
ggcttcgtgaaggatggggacaagctgtgcgtggtgctgggtccctacggccccgagtgg
caggagaacccctaccccttccagtgcaccatcgacgatcccaccaagcagaccaagttc
aagggtatgaagagctacatctcttacaagctggtgcccacgcatacccaggtgcccgtg
cacaggcgctataagcacttcgactggctgtatgcgcgcctggcggagaaattcccggtc
atctcggtgccccatctgcccgagaagcaggccaccgggcgcttcgaggaggacttcatc
tccaagcgcaggaagggtctgatctggtggatgaaccacatggccagtcacccagtgctg
gcccagtgcgacgtcttccagcatttcctgacctgccccagcagcactgatgagaaggcc
tggaaacagggtaagcggaaggctgagaaggatgagatggtgggcgccaacttcttcctc
actctgagcacaccacctgcggccgccctggacctgcaggaggtggaaagcaagatcgat
ggcttcaaatgcttcaccaagaagatggatgacagcgcgttgcagctcaaccacactgcc
aacgagtttgcgcgcaagcaggtgactggcttcaagaaggagtatcagaaggtgggccag
tcctttcggggcctcagccaagcctttgagctggatcagcaggccttctccgtgggtctg
aatcaggccattgccttcaccggagacgcctatgatgccatcggtgaactcttcgctgag
cagcccaggcaggacctggacccagtcatggacctgttagcactgtatcaggggcacctg
gccaacttcccagacatcatccatgttcagaaaggagctcttaccaaagtaaaggagagt
agacgacacgtggaagaagggaagatggaggtccaaaaggccgacggcattcaagaccgc
tgtaacactatttccttcgccacgttggccgagattcatcacttccatcaaattagagta
agagactttaaatcacagatgcagcattttttacaacaacaaataatatttttccaaaaa
gtgacacagaagttggaagaagctcttcataaatatgacagcgtctga

DBGET integrated database retrieval system