KEGG   Rattus norvegicus (rat): 310132Help
Entry
310132            CDS       T01003                                 

Gene name
Osmr
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    310132 (Osmr)
   04151 PI3K-Akt signaling pathway
    310132 (Osmr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    310132 (Osmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    310132 (Osmr)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL6/12 receptor family
   310132 (Osmr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 310132
NCBI-ProteinID: NP_001005384
RGD: 1302983
Ensembl: ENSRNOG00000033192
UniProt: Q65Z14
Position
2q16
AA seq 962 aa AA seqDB search
MAFSVVLHQVTFLLAVLSLRTSQSKVLGEPLQLTPEIHTVSLQSALQEANLEWTVPTFSH
QELNIVFQIEISRMRTSNTIWVGNYSTTVKHEETVHWKWTSDIPLECATHFIRIRAMVDD
AQYPPQSSWSNWSSWKEVNAQVSVPPDTLLIFPEDRLLEEGSNVTICLMIGQNLYNVSCK
LQEEPIRGEQLDSHLSLIKLNNVVFLNNAGTNINCKAMNGTKNTFGTVLFVSKVLEEPKN
FSCETRDFKTLNCLWEPGIDTTLSWHKQRSQHYTLYESFSGRREVSNHRNSHTWQITEDS
QETYNFTLTAENNLRKRSVSISFNLTHRVHPKAPHDVTLKTVGATKAHMTWKVPSRGDYT
LLCQVELQCEGEVIHEHNVSVHTSANYLFSDLEPDTEYKACVRCASANHFWKWSDWMQKK
FRTPEAAPSEALDVWRDVRTENGRHVVTLFWKPLLKSQANGKIISYNIVVENEANPTESE
QYSVRAPALGTNLSLDLHPYKIHISANNSAGASPESLVVLSSHSGHEEVHEKTIKGIKNG
FNISWEPVSGDAIGYVVDWCAHSQTQRCDLQWKNVGPNITSTIITSDAFEPGVRYNFRIF
ERSVEENVRLVEKQRGYTQELAPSVNPGVTIHNLTPNSFSLKWQDYASDFQSGFIKGYLV
YLKSKELQCNPNWERTVLSDKSVLCKYDVDDPETKTLTVENLRPESLYEFLVTPYTSAGQ
GPNETYTKVTTPDVRSHMLLQIILPMTLGVFLSIIVCYWKSQWVKEKCYPDIPNPYKSSI
LSLIKSKKNPHLIMNVKDCIPDVLEVINKAEGSKTQCVGSGKLHTEDVPTKPPLVPTEKD
SSGPMPFVFLENFTYDQSAFDSGSHGFIPGPLKNTPHQLGLLAPPNKLQNVLENDYMKSL
VESPTEETSLIYVSQLASPICGDKDSLVTNPPMPVHGSEYKKQMALPGSLTSASLKENNL
TS
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggctttctctgtggtccttcatcaagtgaccttccttctggcagtgctgtccctgagg
acttcccaaagtaaagtcttgggggagcctttacagttgactcctgagatacacacagtt
tctcttcaatctgcacttcaagaagcgaatttagaatggactgtcccaacctttagtcat
caagaattaaacattgtatttcagatagagatcagtcggatgagaacatccaacaccatc
tgggtggggaattacagcaccactgtgaagcatgaagaaactgtgcattggaaatggaca
tctgatatccccttggaatgtgccacacatttcataagaataagggctatggtagatgac
gcccagtaccctccacagagttcctggagcaactggagttcctggaaagaagttaatgca
caagtttcagttccacctgatacattattaatatttcctgaagacagactgttggaagaa
ggttccaatgtcaccatctgtttgatgattgggcagaatctatataatgtatcctgtaag
ttgcaagaagagccaatccgtggagagcaacttgattcacacctgtcactaataaaattg
aataatgtagtgttccttaacaacgcagggacaaacatcaattgtaaagccatgaatggt
actaaaaatacatttggtactgttctctttgtctcaaaagtgcttgaggaacctaagaat
ttttcctgtgaaacccgagactttaagactttgaactgtttgtgggaacctgggatagac
acgactttgagttggcataaacaacgttcccaacactacactttatatgaatcgttctct
gggagacgtgaggtttctaaccacagaaactcgcatacctggcaaatcactgaagactca
caggaaacatataacttcactctcacagctgaaaacaacctaaggaaaagaagtgtcagc
atcagttttaacctgacccacagagttcatccaaaggctccccatgatgtcactcttaaa
actgtaggtgctacaaaagcccacatgacttggaaggttccctcccgtggagactacaca
cttttgtgtcaggttgaactccagtgtgaaggagaagtgatacatgagcacaatgtttct
gtccacacgagcgccaactacctcttcagtgatctggagccagacacagagtacaaggct
tgtgtgcgctgtgcgagtgccaaccacttctggaaatggagtgactggatgcaaaaaaag
ttcagaacacccgaggctgccccctcagaagctcttgatgtgtggagagacgtgcggaca
gagaatggaagacatgttgtgactttattctggaagccactattaaaatcacaggccaat
ggcaaaatcatatcctataatatagttgtagaaaatgaagccaatccaacggagtcagaa
cagtactctgttcgggcgccagcccttggcacaaacctgagcctggacctgcatccctac
aagattcacatctcagccaacaacagcgcgggggcatctcctgagtccttggtggtcctt
tctagtcattctggacatgaagaggtccatgaaaaaacaattaaaggtataaagaatgga
ttcaatatttcctgggagccggtatctggagacgcgataggctatgttgtggactggtgt
gcacattctcagacccaacgctgtgatttgcagtggaagaacgtaggtcccaatatcaca
agcaccatcatcacctcagacgcttttgagccaggggtccgttacaacttcagaattttt
gaaagatctgtggaagagaatgttcggttagtagagaaacaaagaggatacacccaggaa
ttggctccgtcggtgaatccaggagtgacgattcataacttgaccccaaactccttcagt
ctaaaatggcaggattatgccagcgacttccagtctggctttataaaagggtacctcgta
tatttgaaatccaaggagctgcagtgcaacccaaactgggagaggactgttctgtcagat
aagtcagtgctctgtaaatatgacgtcgatgacccagagacaaagacactcactgtggaa
aaccttcggccagagtccctctatgagtttctcgtcactccatataccagcgctggccag
ggacccaatgaaacatacacaaaggtcacgactccagatgtacgctcccacatgctgctg
cagatcatattacccatgaccctcggcgtcttcctcagcatcattgtgtgttactggaaa
agtcagtgggtgaaggagaagtgctatcctgacattcccaatccatacaagagcagcatc
ctatcactcataaaatccaagaagaatcctcacttaataatgaatgtcaaagactgcatt
ccagatgtccttgaagttataaacaaagcagaaggcagcaagacacagtgtgtaggctct
gggaaacttcacactgaagatgtacccactaagcctccattggtgccaacagaaaaggat
tcctctggccccatgcccttcgtcttccttgagaattttacttacgatcagtcagctttt
gattctggttctcatggcttcattccaggacccctaaaaaacacaccgcaccaactcgga
ctattggctccgcctaacaagttacagaatgtattagaaaacgattacatgaagtccctg
gtcgaaagtccaactgaagaaactagtttgatttatgtgtcccagctggcttcacctata
tgcggagacaaggacagtcttgtcacgaacccacccatgccagtgcacggttcagagtat
aaaaagcaaatggcacttccagggagcctcacatcagcttctctgaaggagaacaacttg
acttcttag

DBGET integrated database retrieval system