KEGG   Rattus norvegicus (rat): 310190
Entry
310190            CDS       T01003                                 

Gene name
Fam105a
Definition
(RefSeq) family with sequence similarity 105, member A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Peptidase_C101
Other DBs
NCBI-GeneID: 310190
NCBI-ProteinID: NP_001032737
RGD: 1563205
Ensembl: ENSRNOG00000012109
UniProt: Q3B7D8
Position
2q22
AA seq 353 aa
MKATRSAPRERERSRTTSGSDQVHSWILVPSQVLHAVWRIARASVMTALSLLSATLSYFR
SLYLYLGHQLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRARLMRKAYEELFW
RYHVKCVRPVKRDNYDALRSVLFQIFSQGLSFPSWMKEKDIVKLPEKLLFSQGCNWIQQY
SFGPEKYTGSNVFGKLRKCVELLKLQWTEFSGMRDYHKRGSMCNSLFSDAILECKLYEAL
KFLMLYQVTEVYEQMKTNKIVPSLFRLLFSRESSPDPLSFMMNHLNSIGDTCGLDQIDMF
ILGYSLQVKIKVFRLFKFNSRDFAVYYPEEPLREWPEISLLTENDHQYHIPVF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaaggcgacgaggagcgcgccgcgggagcgggagcgctctcggaccacctcaggaagt
gaccaagttcactcttggatactagttccaagccaagtccttcatgctgtctggagaata
gcaagggcctctgtgatgacggcgctctctcttctgtcagctaccctcagctacttcaga
agcctgtatttgtatttagggcatcagctgaaatggtggattggctatctacagagaaag
ttcaaaagaaacctcagtgtggaggcagaagtagatctactcagctattgtgcaagagag
tggaagggagaaaccccgcgtgctagactgatgaggaaggcttatgaggaactcttctgg
aggtaccatgttaaatgtgttcgaccagtgaagagagataactatgacgctctcaggtct
gtgttgttccagatcttcagccaaggcctctccttcccatcatggatgaaggaaaaagac
atcgttaagcttcctgaaaagctactcttttctcaaggctgcaactggatccagcagtac
agtttcgggcctgagaagtacacaggttccaatgtgtttggaaagttacggaaatgtgtg
gagttactaaaactgcagtggactgagtttagtgggatgcgagattaccacaagagaggg
agcatgtgtaacagcctcttctccgacgccatcctggagtgtaaactgtacgaagctttg
aagttcctcatgctctaccaggtcacagaagtgtacgagcaaatgaagaccaacaagatt
gtccccagccttttcagactcctgttctcccgagagtcatcaccggatcccttgagcttt
atgatgaatcacctgaattccataggagacacgtgtggtttggatcagatcgacatgttt
atactcgggtattctcttcaagtaaagataaaagtgttccgactgttcaagtttaactcc
agagactttgcagtctactaccccgaggagcctctcagggagtggccagagatctccctg
ctgaccgagaatgaccaccagtaccacattcctgtcttctaa

DBGET integrated database retrieval system