KEGG   Rattus norvegicus (rat): 310207Help
Entry
310207            CDS       T01003                                 

Gene name
Sema5a
Definition
(RefSeq) semaphorin 5A
  KO
K06841  semaphorin 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    310207 (Sema5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema TSP_1
Motif
Other DBs
NCBI-GeneID: 310207
NCBI-ProteinID: NP_001101129
RGD: 1308650
Ensembl: ENSRNOG00000011977
UniProt: D3ZTD8
Position
2q22
AA seq 1074 aa AA seqDB search
MKGACILAWLFSSLGVWRLARPETQDPAKCQRAEHPVVSYKEIGPWLREFRAENAVDFSR
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVQWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTIRSLSNLTEIHDQISGMARCPYSPQHNSTALLTASGELY
AATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTM
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGRDTLVHII
YLATDYGTIKKVRAPLSQSSGSCLLEEIELFPERKSEPIRSLKILHSQSVLFVGLQEHVV
KIPLKRCHFHQTRGACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSVPTCPTRNLTVD
GSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGWG
PWERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNACPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEFQECNILPCPV
DGVWSCWSSWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQTCPENWS
EWSEWSVCDASGTQVRTRQCILLFPVGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMMAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAALNSSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagcctgcatccttgcatggctgttctcaagcctgggagtgtggagacttgct
cggcctgagacccaggaccctgccaagtgccagagagctgagcaccccgtcgtctcctac
aaagaaattggcccctggttacgggaattcagagccgagaatgctgtggatttctcgagg
ttaacatttgacccaggacagaaagaacttgtcgtaggagcaagaaactatctcttcaga
ctacagctcgaggatctgtctctcatccaggctgtgcagtgggagtgtgatgaagccacg
aagaaggcctgttacagcaagggcaaatcgaaggaggaatgtcagaactacatacgagtg
ctcttagtgggcggggaccggctcttcacctgtgggaccaatgccttcacacccgtctgt
accatccgctccttaagtaacctgactgagatccatgatcagatcagtggcatggctcga
tgtccctatagtccccagcacaattctacagctctactcactgccagtggcgagctctat
gctgcaacagccatggatttcccagggcgcgatccagccatttatcgaagtctgggcact
ttacctcctcttcgaactgcacagtacaactccaaatggctcaatgaaccaaactttgtg
tcttcctacgacatcgggaacttcacctacttcttcttccgagaaaatgccgtggaacac
gactgtgggaagactgtgttctccagggcagccagggtctgcaagaatgacattggagga
cgatttcttctggaggatacctggactaccttcatgaaggctcgcctcaactgctctcgg
cctggtgaggtgccgttctactacaacgagcttcaaagcaccttcttcctgccggagctg
gatctgatctacggcatcttcaccaccaatgtaaacagcattgctgcctctgctgtctgt
gtcttcaacctgagcgccatctcacaggccttcaatggacccttcaagtaccaagagaac
tctcgctcagcctggctgccttatcccaaccccaaccccaattttcagtgcggcaccatg
gaccagggcctgtatgtaaacctgacggaaagaaacctacaggatgctcagaagttcatc
ctgatgcatgaagtggtgcagccagtgaccacagtgccttccttcatggaagacaacagc
cgtttctcccatgtggctgtcgatgttgtgcaaggcagggacacccttgtccatatcatc
tatctggccacagattatggcaccattaaaaaagtgcgggctccgctgagtcagagctcg
ggcagctgtttgctagaagagattgagctttttccagagaggaagagtgagcccatcagg
agcctaaagatcctccacagccagagtgtcctatttgtggggctacaggagcatgtggtc
aagatccccctgaagagatgccattttcatcaaacacgtggtgcctgcattggtgctcag
gacccttactgtggctgggatgcggtgatgaagaagtgcaccagcctggaggagagcctg
agcatgacccagtgggatcagagcgtccccacctgtccgaccagaaatctcaccgtagat
gggagctttggcccgtggtctccatggacaccctgtactcacactgatggcactgctgtg
ggatcctgcctctgccggtcccgatcctgtgacagcccagctccacagtgtggcggctgg
cagtgtgagggccctagaatggagatcaccaactgttccaggaatggaggctggactccc
tggacctcctggtctccctgcagcaccacttgtggcattggcttccaggtgcggcagcgc
tcctgcagcaaccctacgcccaggcatggagggcgtgtgtgcgtgggccagaacagggag
gaaagatactgcaatgaacatttactctgcccaccacacgtgttctggacaggctgggga
ccttgggaacgctgcacagcccagtgcgggggtggcattcaagctcgccgtaggacctgt
gaaaatgggcctgactgtgcaggatgcaatgtggaataccagccttgtaacaccaatgca
tgcccagagttgaagaagaccacaccatggaccccctggacacctgtcaacatctctgac
aatgggggccactatgagcagcggttccgctacacctgtaaagctcgcctgccagatcca
aacttattggaagtaggaagacaaaggatagaaatgcggtactgttctagtgatgggacc
agtggctgctccacagatggactttctggagactttctaagagctgggagatactctgcc
catacagtcaatggggcatggtcagcctggacttcctggtcacagtgcagcagagactgc
agcaggggcattcgaaacaggaagcgtgtttgcaacaacccagagcccaagtatggaggt
atgccatgccttggtccatcactggagttccaggaatgcaacattttaccctgtccagtg
gatggtgtgtggtcttgctggtcatcctggtctaaatgctcagcaacttgtgggggtgga
cactacatgagaacccgttcgtgtacgaatccagccccagcatacggaggggacatctgc
ctgggactgcacacggaagaggccctctgtaacacacagacctgcccagagaactggtca
gagtggtcagagtggtctgtgtgtgatgcatctggtacccaggtccgtactcggcagtgc
atccttctgtttcctgtgggcagccagtgttctggaaatactacagagagccggccttgt
gtatttgactctaatttcatcccagaagtgtctgtggcaagatccagcagcgtagaagag
aaaaggtgtggagagttcaacatgttccacatgatggctgtgggacttagcagttccatc
ctcggctgcctccttacactgcttgtctacacctactgccagcggtaccagcagcagtcc
catgatgcaactgtcatccatcctgtttctcccgccgccctcaacagcagcataactaac
cacatcaacaaactggataaatacgattccgtggaggccatcaaggcatttaacaaaaac
aacttgatcctagaggagagaaacaaatacttcaacccacatctcactgggaagacctac
tccaacgcctactttacagatctcaacaattatgatgaatactag

DBGET integrated database retrieval system