KEGG   Rattus norvegicus (rat): 310218Help
Entry
310218            CDS       T01003                                 

Gene name
Car1, CA-I, Ca1
Definition
(RefSeq) carbonic anhydrase I
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    310218 (Car1)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     310218 (Car1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 310218
NCBI-ProteinID: NP_001101130
RGD: 1309780
Ensembl: ENSRNOG00000010698
UniProt: B0BNN3
Position
2q23
AA seq 261 aa AA seqDB search
MASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEI
VNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELH
LVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNF
DPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAV
PVLSNHRPPQPLKGRTVRASF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgcagactggggatatgatagcaaaaatggtcctgaccaatggagcaaacta
tatcccattgccaatggaaacaaccagtctcctattgatattaaaaccagcgaagccaaa
catgattcctctctgaaaccagtcagcgtctcctacaatcctgcaactgccaaagaaatt
gttaatgtgggacattctttccatgtagtttttgatgacagtagcaaccagtcagtgctg
aaaggtggccctcttgctgatagctatcggctcacccagttccattttcactggggcaac
tcaaacgaccatggctctgaacacaccgtggatggagccaaatattctggagagcttcac
ttagttcactggaattcagccaagtactccagtgctgctgaagccatctcgaaggctgat
gggctggcaatcattggggttttgatgaaggttggtccagccaacccaaacctgcagaaa
gtactggatgccctaagctcagttaaaactaagggaaaacgagccccattcaccaatttt
gacccttccagtctccttccttcgtctctggattactggacctactttggctctctgacc
caccctcctcttcatgaaagcgtgacttgggtgatctgcaaggagagcatcagtctaagc
ccagaacagctggcacagctccgtggtcttctgtcaagtgccgagggagagcctgcggtt
ccagttctgagcaaccaccgtccaccacagcccctgaagggcagaacagtcagagcctca
ttttga

DBGET integrated database retrieval system