KEGG   Rattus norvegicus (rat): 310303Help
Entry
310303            CDS       T01003                                 

Gene name
Kcnmb3
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 3
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    310303 (Kcnmb3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    310303 (Kcnmb3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    310303 (Kcnmb3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated
   310303 (Kcnmb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB DUF3617
Motif
Other DBs
NCBI-GeneID: 310303
NCBI-ProteinID: NP_001098030
RGD: 1311852
Ensembl: ENSRNOG00000027836
UniProt: A7VL23
Position
2q24
AA seq 239 aa AA seqDB search
MQPFSIPVQITLQGGRRRQGRTALPASGISNGDPLKVHPKLPSSAGEDRATLLGIAMMAS
SVLMFFLLGTTVLKPFMLSSPREESNCTTVHTHIADDWLDFAFTCEGSCQGQGTYPCLQV
FVNLSHSGQKVLLHYDEEAIRTNPKCFYTPKCHGDRDHLLNSALDIKEFFDHNNGTFPCF
YSPDGPLGVVLRKSGHKVVFHCLFWPLLTLLGGALIVGLVRLTQHLSFQCEKYRAVVRA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatcccggtccaaatcacactacagggtggtcggaggcgccaaggg
aggacagcacttccggcctcaggcataagcaatggagatcccctgaaggtgcacccaaaa
cttccatcgagcgctggtgaggaccgggccacgctgctgggcatcgccatgatggcctcc
tccgtgctgatgttcttcctgctggggaccactgtgttgaagcccttcatgctcagctct
cccagagaagaatcaaactgcaccactgtccacacacacattgcagatgattggctggac
tttgccttcacctgtgagggtagctgccagggccaggggacatacccttgcctgcaggtg
ttcgtcaaccttagccactcgggacagaaagtgcttctccattacgatgaggaggccatc
aggaccaaccccaagtgcttttacacacccaagtgtcacggagacagggatcatctgctc
aacagtgccctggacatcaaggaattcttcgatcacaacaatggaactttcccctgcttc
tacagtcctgacgggcccctgggagtggtcctgaggaagtctggccacaaggttgtcttt
cactgcttattttggcctttactgacattgctgggaggcgctctgattgttggtttggtt
aggctaacacaacatctgtcctttcagtgtgaaaagtatagagcagtggtaagagcttaa

DBGET integrated database retrieval system