KEGG   Rattus norvegicus (rat): 310324Help
Entry
310324            CDS       T01003                                 

Gene name
Dcun1d1, Tes3
Definition
(RefSeq) defective in cullin neddylation 1 domain containing 1
  KO
K17822  DCN1-like protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    310324 (Dcun1d1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   310324 (Dcun1d1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin_binding UBA_4 TAP_C VMR2
Motif
Other DBs
NCBI-GeneID: 310324
NCBI-ProteinID: NP_001101138
RGD: 1309668
Ensembl: ENSRNOG00000012734
UniProt: D3ZRV0
Position
2q25
AA seq 207 aa AA seqDB search
MLEDAVNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRES
VKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQC
EFSKQEFMDGMTELGCDSVEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDL
EMAIAYWNLVLNGRFKFLDLWNKFLLG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagacgccgtgaacaagttgaaatcatcgcagaaggataaagttcgtcagttt
atgatcttcacacaatctagtgagaaaactgcagtaagttgcctttctcagaatgactgg
aagttagatgttgcaacagataatttttttcaaaatccagaactttatatacgggagagt
gtaaaaggatcgttggacaggaagaagttagaacaactgtacaatagatacaaagaccct
caagatgaaaataaaattggaatagatggtatacagcagttctgtgatgacctggccctc
gatccagccagcatcagtgtgttgatcattgcatggaagttcagggcggccacacagtgc
gagttctccaaacaggagttcatggatggcatgacagagttaggatgtgacagcgtagaa
aaactaaaggcccaaatacccaagatggagcaagaattgaaagaaccaggacgatttaag
gacttttaccagtttacttttaattttgcaaagaacccaggacaaaaaggattagatcta
gaaatggccattgcttactggaacttagtgcttaatggaagatttaaattcttagactta
tggaataaatttttgttggggtga

DBGET integrated database retrieval system