KEGG   Rattus norvegicus (rat): 310327Help
Entry
310327            CDS       T01003                                 

Gene name
Qrfpr, AQ27, Gpr103
Definition
(RefSeq) pyroglutamylated RFamide peptide receptor
  KO
K08378  pyroglutamylated RFamide peptide receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    310327 (Qrfpr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Orexigenic neuropeptide QRFP
    310327 (Qrfpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx T4SS_CagC 7tm_4 Herpes_US9
Motif
Other DBs
NCBI-GeneID: 310327
NCBI-ProteinID: NP_937842
RGD: 728380
Ensembl: ENSRNOG00000014414
UniProt: P83858
Position
2q25
AA seq 433 aa AA seqDB search
MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKVAFALAGALIFALAL
FGNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKM
VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPM
WHVQRLEIKYDFLYEKEHICCLEEWASPVHQRIYSTFILVILFLLPLVVMLVLYSKIGYE
LWIKKRVGDSSALQTIHGKEMSKIARKKKRAVIMMVTVVALFAACWAPFHVVHMMVEYSN
FEKEYDDVTIKMVFAVAQTIGFFNSICNPFVYAFMNENFKKNFLSAVCYCIVKESSSPAR
KPGNSGISMMQKRAKLSRPQRPVEETKGDTFSDASIDVKLCEQPREKRQLKRQLAFFSSE
LSENSTFGSGHEL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgctcaacatcaccgcggagcagttctcccggctgctgagcgcgcacaacctg
actcgggagcagttcattcatcgctatgggctgagaccgctggtctacactccggagctg
cccgcgcgtgctaaagtggcctttgcgctggcaggagcactcatttttgccctggcgctc
ttcggcaactctctggtcatctatgtggtgacccgcagcaaggccatgcgcaccgtcacc
aacatcttcatctgctctctggcactcagtgatctgctcattgccttcttctgcatcccc
gtcacgatgctccagaacatctccgacaagtggctgggtggtgccttcatctgcaagatg
gtaccctttgtccagtccacggccgtcgtgacagaaatcctcaccatgacctgcatcgct
gttgagaggcaccaaggacttgtccatccttttaaaatgaagtggcagtacaccacccga
agggccttcacgatcttgggcgtggtctggttggcggccatcatcgtaggatcacccatg
tggcacgtgcaacgccttgagattaagtatgacttcctctatgaaaaagaacacatctgc
tgcttggaagaatgggccagccccgtgcaccagagaatctacagcaccttcattctcgtc
atcctcttcctcctgcctcttgtggtaatgctagtcctctatagcaagattggctatgaa
ctgtggatcaagaagagagtgggagacagttcagcgcttcaaactatccacgggaaagaa
atgtccaaaatagccaggaagaagaagcgggctgtcattatgatggtgactgtggtggct
ctctttgctgcatgctgggcacctttccacgttgttcacatgatggttgagtacagtaat
tttgaaaaagaatatgatgatgtcacaatcaagatggtctttgctgtcgcgcagacaatt
ggctttttcaactccatctgtaatccctttgtgtatgcgtttatgaatgaaaacttcaaa
aagaattttctgtctgctgtttgttattgcatagtgaaagaatcctcctccccagcacgg
aagcctgggaattctggaatatcaatgatgcagaagagagcaaagttatctcgaccacag
cgtccagtggaagaaaccaaaggagacacattcagtgatgccagcattgatgtcaaattg
tgcgagcagccgcgggagaaaagacaactcaagagacagctagccttcttcagttctgaa
ctttctgaaaactctacttttggtagtggccatgaactgtaa

DBGET integrated database retrieval system