KEGG   Rattus norvegicus (rat): 310376Help
Entry
310376            CDS       T01003                                 

Gene name
Nim1k, Nim1, RGD1308116
Definition
(RefSeq) NIM1 serine/threonine protein kinase
  KO
K16310  serine/threonine-protein kinase NIM1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    310376 (Nim1k)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     310376 (Nim1k)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   310376 (Nim1k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1 Kdo FlgM
Motif
Other DBs
NCBI-GeneID: 310376
NCBI-ProteinID: XP_001076547
RGD: 1308116
Ensembl: ENSRNOG00000016353
UniProt: D4A9H8
Position
2q15
AA seq 436 aa AA seqDB search
MTAVVVNGGGLVNTHCDRWDRRDSAEGSCQTEGSKDGEEDQPRQLTPFEKLTQDMCQDEK
VVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSR
EISSMEKLHHPNIVRLYEVVETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQI
VSAVKHMHENQIIHRDLKAENVFYTSSTCVKVGDFGFSTVSKKGEMLNTFCGSPPYAAPE
LFRDEHYVGVYVDIWALGVLLYFMVTGTMPFRAETVAKLKKSILEGAYSIPQHVSEPCHR
LIRGVLQPTPAERYGINYIMSNEWMRGVPYPSPLEPFQLDPKHLSETSTLKEEENEVKST
LEHLGITDEHIRNNQGRDARSSITGVYRIILHRVQRRKALESVPMATLPEPKDKDLKKGS
RVYRGIRHTSKFCSIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagtggttgtgaatggaggcggcctggtgaacacacattgtgacaggtgggac
cgtagagacagtgcggaaggcagctgtcagaccgagggcagcaaggacggcgaggaggac
cagccgcgccagctgacacctttcgagaaactgactcaggacatgtgccaagatgagaag
gtggtgagggagatcacgctggggaaacgcataggcttctatcgaattcgaggggagatc
ggaagcggaaacttttcccaggtcaagctgggaattcactccctaaccaaagaaaaggtg
gccattaagattctggacaaaaccaagttagaccagaaaacccaaaggctgttatccaga
gaaatttccagcatggaaaagttgcaccatcccaacattgtccgtctttatgaagtcgtg
gagaccctgtccaagctccacctagtgatggagtatgcaggaggtggggagctctttggg
aaaattagcaccgaggggaaactttctgaaccggaaagcaagctcatcttctcccagatc
gtgtctgccgtgaagcacatgcatgaaaaccaaattatccacagagatctgaaagcagaa
aacgtcttctataccagtagcacttgtgtgaaggtgggggattttggattcagcaccgta
agtaagaaaggtgagatgctgaacaccttctgtgggtctccgccctacgctgcaccggaa
ctcttccgtgacgagcactatgttggcgtttatgtggatatctgggccttgggtgtcctt
ttgtacttcatggtgactggtacgatgccatttcgagcagaaaccgtggccaaactgaaa
aagagcatcctcgagggtgcctacagcataccccaacacgtgtcagagccctgccaccgg
ctcatccgaggagtccttcagcccacgcccgcagagaggtatgggatcaactacatcatg
agcaacgaatggatgcgaggggtgccgtacccctcccctctggaacctttccaactggat
cctaaacatttgtcggaaactagcaccctcaaagaagaagaaaacgaggtgaaaagcact
ttagagcacttggggatcacagacgaacatatccggaataaccaagggagagacgctcga
agctctatcacgggggtctatagaatcattttacatcgagtgcaaagaagaaaagcactg
gaaagtgtgccaatggcgacactaccagaacctaaagacaaggacctaaagaaagggtcc
cgtgtctacagaggcataagacacacatctaaattttgttcaattttataa

DBGET integrated database retrieval system