KEGG   Rattus norvegicus (rat): 310378
Entry
310378            CDS       T01003                                 

Gene name
Nnt
Definition
(RefSeq) nicotinamide nucleotide transhydrogenase
  KO
K00323  H+-translocating NAD(P) transhydrogenase [EC:1.6.1.2 7.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    310378 (Nnt)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     310378 (Nnt)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.1  proton-translocating NAD(P)+ transhydrogenase
     310378 (Nnt)
SSDB
Motif
Pfam: PNTB AlaDh_PNT_C AlaDh_PNT_N PNTB_4TM Pyr_redox_2
Other DBs
NCBI-GeneID: 310378
NCBI-ProteinID: NP_001013175
RGD: 1587346
Ensembl: ENSRNOG00000026842
UniProt: Q5BJZ3
Position
2q15
AA seq 1086 aa
MAHLLKTVVTGCLCPSVSNLGSCKVLPGKKDFLRTFRTHQALWCKSPAKPGIPYKQLTVG
VPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDDLYRAAGAQIQGTKEVL
ASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDLLNKLSERKTTVLAMDQV
PRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGL
ASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAE
MKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPG
ELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFHFEVKDDFDFGTMS
HVIRGTVVMKDGNVIFPAPTPKNIPKEAPAKQKTVAELEAEKAGTVSMYTKTLRTASVYS
AGLTGMLGLGIVAPNLAFSQMVTTFGLAGIIGYHTVWGVTPALHSPLMSVTNAISGLTAV
GGLALMGGHFYPSTTSQSLAALATFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLL
PGGTFVGGYLAALYGGYNIEEIMYLGSGLCCVGALGGLSTQGTARLGNALGMIGVAGGLA
ATLGGLKPDPQLLAQMSGAMAMGGTIGLAIAKRIQISDLPQLVAAFHSLVGLAAVLTCMA
EYIVEYPHFAMDATSNFTKIVAYIGTYIGGVTFSGSLVAYGKLQGILKSAPLLLPGRHAL
NAGLLAASVGGIIPFMADPSFTTGIMCLGSVSALSTLMGVTLTAAIGGADMPVVITVLNS
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGG
KPMEISGTHTEINLDNAVEMIREANSIVITPGYGLCAAKAQYPIADLVKMLTEQGKKVRF
GIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINSDFPDTDLVLVIGANDTVNSAAQEDP
NSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKV
RESYQK
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcacatctactgaaaacggtggtgactggctgtttatgtccttctgttagcaatttg
gggtcctgtaaggttctacctgggaagaaagactttttacgaacatttcgtacccaccag
gcactgtggtgtaaatccccggcaaaaccaggaattccatataagcagttgacagttggg
gtccccaaggagattttccaaaatgagaagcgagttgccttgtctcctgctggtgtccag
gccctggtcaagcagggttttaacgttgttgtggaatcaggagcaggcgaagcttccaaa
ttcccagatgatctctacagagcagcaggggcccagatccaaggaacgaaggaagttctg
gcttctgatctggtggtcaaagtgagggcccccatggtgaacccgacgttaggtgctcat
gaagctgactttttaaagccctcaggaactctaattagcttcatttacccagcccaaaat
ccagacttgctaaataaactctccgaaagaaaaactacagttttggcgatggaccaggtt
ccgagggtgacaatagctcagggctatgatgctctcagctccatggccaacatttctggt
tataaggctgttgttttagcagccaatcattttggaaggtttttcactggtcagatcaca
gctgctggaaaagtccccccagcgaagatcctgatagttggtggtggcgttgccgggctc
gcttctgcaggggcagcaaagtcaatgggcgcagttgtccgaggatttgatacaagagct
gccgccttggaacagttcaaatcccttggtgctgaacccttggaggtggacttgaaggag
tctggtgagggccaaggaggatacgcgaaggagatgtccaaagagtttattgaggcggaa
atgaagctctttgctcagcaatgcaaggaagtggacatccttatcagcacagctctgatt
ccaggtaagaaagctcctgttctatttagtaaagaaatgatcgagtccatgaaggaaggt
tcagtagttgtggatttagctgctgaggccggcggaaactttgaaacgactaaaccggga
gaactttacgttcataagggaatcactcatattggctacacagacctccccagccgcatg
gccactcaggctagcactctgtactccaacaacatcaccaagctcctgaaggccatcagc
cccgacaaggacaattttcactttgaagtgaaggatgactttgactttggtacaatgagt
cacgtcattcgaggaaccgtggtgatgaaggatggcaatgtgattttcccagctcccaca
ccaaaaaatattcccaaagaagccccagccaaacagaagaccgtggctgagctggaagca
gagaaggcaggcactgtctcaatgtacacgaagacactgaggacagcatccgtgtattca
gcaggtctcaccgggatgctaggtttgggcatcgtggcccccaatctagccttttctcag
atggtgaccacctttggcctggcgggcattattggttaccacactgtctggggagtgacc
cctgctctccactcaccactgatgtctgtgaccaatgctatctcaggtttgactgcagtt
ggtgggctggcgttgatgggagggcatttttatccctccacaacttcccagagtcttgct
gctcttgctacattcatatcgtcagtcaacattgcaggtggttttctggtgactcagaga
atgttggacatgttcaagcgacccacggaccctccagaatacaattacctgtatctgctc
cctggcggcaccttcgtggggggatatttagcagctctctacggtggttataacatcgaa
gaaatcatgtacctgggctcaggtttgtgctgtgttggggccctgggcggcctttccact
cagggaacagctcgactcggcaatgccttgggcatgattggggttgcaggaggcctggca
gctacccttggaggcctgaagccggacccacagctgttagctcagatgtccggagcaatg
gcgatgggcggcaccatcggactggcgattgcaaagcggatccagatctccgacctgcct
caactggttgctgctttccacagtttagtgggtctggcggcagtgctcacatgcatggcc
gagtacatcgtggagtatccacatttcgcaatggatgccacttcaaatttcaccaagatt
gtggcctacattggcacttacatcggcggagtcacctttagtgggtctctggttgcctac
ggaaaattacagggtattctgaagtcagcccctctgctgctccctggaaggcacgcgctc
aatgcaggcttgctggctgctagcgtggggggaataatcccatttatggctgaccctagt
tttaccacaggcatcatgtgtctgggctctgtgtccgcactctctactctgatgggtgtg
accttgacagctgccattggcggtgctgacatgcctgttgttatcactgtgctaaacagc
tactccggctgggctctgtgtgcggagggcttcctgctcaacaacaacctgttgaccatt
gtgggagcactcatcggctcctcgggcgccatcttgtcgtacatcatgtgtgtggcaatg
aaccgttccctggcaaatgtaattctcggaggctatggtacgacttcaacagctggtgga
aaacccatggaaatttccggcacacatacagaaatcaacctggacaatgcagtcgagatg
atccgggaagctaacagcattgttattactccaggatatgggctctgtgcagctaaagct
cagtaccccattgccgatttggtgaagatgcttaccgaacaaggcaagaaagtcaggttt
ggaatccacccagttgcgggccgaatgcctggtcagcttaatgtgctcctggccgaggca
ggagtgccctatgatattgtgctagaaatggatgagatcaacagtgatttcccagatacc
gatctggttcttgtcattggagctaatgacaccgtgaattcagcggctcaggaagacccc
aattctattattgcaggcatgccagtcctcgaggtctggaagtccaaacaggtcattgtc
atgaagaggtcccttggtgttggctacgctgcagtggacaatccaatcttctacaaacct
aacacagccatgcttctgggggacgccaagaagacatgtgatgctctgcaggccaaagtt
cgagaatcctatcagaagtga

DBGET integrated database retrieval system