KEGG   Rattus norvegicus (rat): 310418
Entry
310418            CDS       T01003                                 

Gene name
Frem2, RGD1566012
Definition
(RefSeq) Fras1 related extracellular matrix protein 2
  KO
K23380  FRAS1-related extracelluar matrix protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    310418 (Frem2)
SSDB
Motif
Pfam: Cadherin_3 Calx-beta Big_9 Cadherin_4
Other DBs
NCBI-GeneID: 310418
NCBI-ProteinID: NP_001232907
RGD: 1566012
Ensembl: ENSRNOG00000021670
UniProt: F1T1U1
Position
2q26
AA seq 3158 aa
MATRGRWTAKYSNFQSILTQSPRLLLLLLSLVSRVSTQDAAPGAAFLSLGLSGTSGVPTE
EAIVVANRGLRVPFGREVWLDPLRDLVLQVQPGDRCTVAVLDNDALAQRPGRLSPKRFAC
DYGPGEVRYSHLGARSPSRDRVRLQLRYDAPGGAIVLPLALEVEVVFTQLEVVTRNLPLV
VEELLGTSNALDARSLEFAYQPETEECRVGILSGLSALPRYGELLHYPQVPGGTGERGSS
ETPLMDCKAFQELGVRYRHTALSHSPNRDWLPMVVEIHSRGAPVGSPALKREHFQVLVRI
RGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAESNPDLLIFNLTSAFQPGQGY
LVSTDDRSLPLSSFTQRDLRLLKIAYQPPSEDSDQERLFELELEVVDPEGAASDPFAFMV
VVKPMNTLAPVVTRNTGLILYEGQYRPLTGPVGSGPQNLVISDEDDLEAVRLEVVAGLRH
GHLVILGSPSSDPAPKTFTVAELAAGQVVYQHDDRDGSLCDNLVLRMSDGGGRHQVQFLF
PITLVPVDDQPPVLNANTGLTVAEGDTVPIPPSTLSATDMDSDDSQLLFVLEPPFSSSGR
LLLRQTHAPQEEQGLWHKQGSFYERMVTEWRQQDITEGKLFYRHSGPHSPGPVMDQFLFR
VQDNQDPPNQSGIQRFVIRIHPVDRLPPELGSGCPLRMVVQESQLTPLRKRWLHYTDLDT
DDRELHYTVTQPPTDTDENHSPAPLGTLVFTDNPSVVVTHFTQAQVNHHKIAYRPPGQEL
GVAARVAQFQFQVEDRAGNVAPGTFTLYLQPVDNQPPEIVNTGFTVEEKGHHVLRETELH
VSDVDTDVAHISFTLTQAPKHGHLQISGRPLHVGGQFRLEDIKQGRISYLNSGDESLTDS
CSLEVSDRHHVVPITLRVNVRPADREGAMSVLPAGTLESYLDVLENGATEVTANIIKGTY
RDTDDLMLTFLLEGPPLYGEILVHGAPAEQFTQRDILEGSVVYAHTSGEIGLLPKADSFN
LSLSAMSQEWRIGSSVIQGVTVWVTILPVDSQAPEISVGEQFVVLEGDKSLISLTHLSAE
DVDSLMDDLLCTIVIQPTSGYVENISPAPGSEKSRAGIAISAFTLKDLRQGHINYVQSVH
RGVEPVEDRFIFRCSDGINFSERQIFPIVIIPTNDEQPEMFMREFMVMEGMSLVVDTPIL
NAADADIPRDDLTFTITRFPTHGHIMNQLINGTVLVESFTLDQIIESSSIIYEHDDSETQ
EDSFVIKLTDGKHSVEKMALIMVIPVDDETPRMAINNGLEIEIGETKVINNKVLAATDLD
SDDKSLVYIIRYGPGHGLLQRRKPLGVFENITLGMNFTQDEVDRNLIQYVHFGQEGIRDL
IKFDVTDGTNALIDRYFYVSIGSVDIVFPDVVSKGVSLKEGGKVTLTTDLLSTSDLNSPD
ENLVFTITRAPMRGHLECTDQRGLSITSFTQLQLAGNKIYYIHTAEDEVKMDSFEFQVTD
GRNPVFRTFRISISDVDNKKPVVTIHNLVVSESESKLITPFELTVEDRDTPDRLLKFIVT
QVPVHGHLLFNNTRSVMVFTKQDLNENLISYKHDGTESTEDSFSFTVTDGTHSDFYVFPD
TVFETRRPQVMKIRVLPVDNRVPQIVVNKGASTLRTLPTGHLGFMITSKILKVQDRDSLH
FSLRFIVTEAPQHGYLLNLGQGNHSVTQFTQADIDDMKICYVLRERANATSDVFHFIVED
DGGNRLTNQHFRLNWAWISFEKEYYLINEDSKFLDIVLKRRGYLGETSFISISTRDGTAE
KDKDFKGKAQKQVQFNPGQTRASWRVRILSDGEHEHSETFQVVLSEPVLAVLEFPEVTTV
EIIDPGDESTVFIPQSEYSVEEDVSELFIPIRRSGDISQELMVICYTQQGTATSTVRTSV
LSYSDYISRPEDHSSVIRFDKDEREKMCRVVVIDDSLYEEEETFQVLLSMPMGGRIGNKF
PGANVTILTDKDDEPAFYFGDTQHSVDESAGYVEVQVWRTGTDLTKPSSVTVRSRKTEPP
SADAGTDYVGISRNLDFAPGVSMQTVRVVILDDLGRPVLEGIEKFELVLRMPMNAALGEP
SKATVSINDSASDLPKMQFKERVYTCSENDGHVVAMIYRSGDLQHRSSVRCYTRQGSAQV
MMDFEERPNTDISIVTFLPGESEKPCVLELMDDDLYEDVEELRLVLGTPQGSSAFGAAVG
EQNETLIKIQDDADKAVIKFGETKFSVTEPSRPGESVVVKIPVIRQGDTSKVSIVRVHTK
DGSATSGEDYHPVSEEIEFKEGETQHTVEIEVIFDGVREMREAFTVHLKPDENMVAETQT
TKAIVYIEEINSMADVTFPSVPHIVSLMVYDDTFKGREDAGPVSGYPIICITACNPKYPD
YDKTGSICASENINDTLTRYRWLTSAPTGPDGVASPMREVDFDTFFTSSKMITLDSIYFQ
PGSRVQCAARAVNTNGNEGLELMSPIVTIAREEGLCQPRVPGVVGAEPFSAKLRYTGPED
PDFANLIKLTVTMPHIDGMLPVISTRELSNFELTLSPDGTRVGNHKCSNLLDYSEVRTHH
GFLTNATKNPEVIGETYPYQYSAPVRGSSTLRFYRNLNLEACLWEFVSYYDMSELLADCG
GTIGTDGQVLNLVQSYVTLRVPLYVSYVFHSPVGVGGWQHFDLKSELRLTFVYDTAILWN
HGIGSPPEAELQGSLYPTSMRIGEEGRLAVNFKTEAQFHGLFVLSHPASFTSSLIVSADH
PGLTFSLRLIRSEPTYNQPVQQWSFISDFAVRDYSGTYTVKLVPCTTPSNQEYRLPVTCN
PREPVTFDLDIRFQQVSDPVAAEFSLNTHMYLLSKKSLWLSDGSMGFGQESDVAFAEGDV
IYGRVMVDPVQNLGDSFYCSIEKVFLCTGDDGYVPKYSPANAEYGCLADSPSLLHRFKIV
DKAQPETQATSFGDVLFNAKLAVDDPEAALLVNQPGSDGFKVDSTPLFQVALGREWYIHT
IYTVRSKGTSHRGIGKRSLEYQYHSVVQHGPPQATTKSWKKRAVRSTPSLAGEIGAENNR
GTNIQHISLDRRGKRQVPHGRIPPDGILPWELNSPSSEMSLVTVLGGISVGLLAVCLAVA
VAVMCRNRSIKGKDAPKGSGSTEPMMSPQSHYNDSSEV
NT seq 9477 nt   +upstreamnt  +downstreamnt
atggccacccgcgggcgctggacagccaagtactccaacttccagtctatactcacacag
tcgcccagactgctgctgctgctcctgtcactggtaagccgcgtctccacacaggatgca
gcccctggcgctgcatttctatccctgggtctctccgggacttcgggggtccctaccgag
gaagctatagtggtggcgaaccgcgggctccgtgtgcccttcggtcgcgaagtctggctg
gatccgttgcgtgacttggtgctgcaggtgcagccaggagaccgctgcacagtggccgtg
ctagacaacgacgcgctggcccagcggcccggccgcttgagtcccaagcgttttgcgtgc
gactacggcccgggtgaggtgcgttactcgcacctgggtgctcgcagcccttcccgcgac
cgcgtccggctgcagctgcgctacgatgctccaggaggggccatagtcttgccattggca
ctagaggtggaagtggttttcacccagctggaggttgtgactcggaatttacctctggtc
gtggaagaactgctagggaccagtaatgccctggatgctcggagcttagagttcgcctac
cagcctgagaccgaggagtgccgcgtgggcatcttgtcaggtttgagcgctttgcctcgt
tatggagaactcctgcactacccacaggtcccgggagggaccggagagagagggtcctcc
gagacccctttgatggactgcaaagcattccaggagctgggagtgcgctatcgtcacaca
gccctgagtcactcacctaacagggactggctgcctatggtggtggagatacattcaaga
ggggctccagtgggcagcccggctttaaagcgtgagcatttccaggtgcttgtgaggatc
cggggaggtgcggagaacactgcgcccaagcccagtttcgtggccatgatgatgatggag
gtagaccagtttgtactgactgctctcactccagacatgctggcagcagaggatgctgaa
tccaacccggaccttttgattttcaacctcacctctgccttccagcctgggcaaggctac
ttggtgagcactgatgatagaagcctgcctctgtcctcctttacacagcgggatttgcgc
ctgctgaagattgcctaccagcctccctctgaagactccgatcaggagcgcctctttgag
ctagagctggaggtagtggaccctgaaggagcagcctcagaccctttcgccttcatggtg
gtggtgaaacccatgaacacactggctccagtggtcacacggaacactggcctcattctc
tatgagggtcagtatcggccactcacgggtcctgtaggcagtggaccccagaacttggtc
atcagtgatgaagatgacctagaagctgtgagactggaggtggtggccgggctccggcat
ggtcaccttgttattctgggttctcccagtagtgaccctgctcccaagaccttcactgtg
gctgagctggccgctggccaggtggtctaccagcatgatgacagagacggttcactgtgt
gacaacttggtgctgcgcatgtcagatggaggaggcaggcaccaggtccagttcctgttc
cctatcactctggtgcctgtggatgaccagccacctgtcctgaacgccaacactgggctg
acagtggcagagggtgacaccgtgccaatcccgccctcgactctgagtgcaactgatatg
gactcggatgactctcagctgctttttgtactggagccgcccttctcaagctcaggacgc
ctgcttctccgccaaacgcatgctccccaggaagagcagggtctgtggcacaaacaaggg
tccttttatgagcgaatggtgacagagtggcggcaacaggatataacggaggggaaactc
ttctacaggcactcggggccccacagccctgggccagtgatggaccagttcctgtttaga
gtccaagacaatcaagacccccctaatcagtctgggatccagaggtttgtaatacgcatc
catcccgtggaccgtctccctccagaactgggcagtggttgtccccttcggatggtggta
caggaatcccagctcacaccactgaggaaaaggtggctgcactacactgacctagacaca
gacgaccgagagctccactacacagtgacccagccccctacggacacagatgagaaccac
tcaccggctccgctggggactctggtcttcactgataatccctcagttgtggtgacccat
tttacccaagcccaggtcaaccatcataaaattgcttacaggcccccagggcaggagcta
ggagtagcagcccgagtggctcagttccagttccaagtagaggatcgagctgggaatgtg
gctccaggcaccttcaccctctacctgcagcctgtggataaccagccccccgagattgtc
aacacgggcttcactgttgaggagaagggccaccacgtccttcgtgagactgagctgcat
gtgagtgacgttgacacggatgtggcccacatctcgttcactctcacacaggcccccaaa
catggccacttgcaaatatctggacggccactgcatgtaggaggacagttccgtttagag
gacataaagcagggcagaatttcctatctgaatagtggggacgaatctttgactgacagc
tgctccctggaggtcagcgacagacaccacgtggtgccaatcactctcagagtgaacgtt
cggccagcggaccgtgaaggtgctatgtcagtccttcctgctggtactctggagtcctat
ctagatgttttggagaatggggctaccgaagtcactgccaacatcattaaggggacctat
cgggataccgatgatttgatgttgactttcctgttggaaggtccgcccttatatggggag
atcctggtccacggagctccagccgagcagttcacccagagggacatcctggagggctct
gttgtctacgctcataccagtggtgagattggcctgttgcccaaagcagactcttttaac
ctgagtctgtcagctatgtctcaagaatggagaattggtagcagtgttatccaaggcgtt
actgtgtgggtgaccatcctccccgtggacagccaagcccctgaaatttctgttggtgag
cagtttgtggtgctggaaggggacaagagtttgataagcctgacccacctaagtgctgag
gacgtggactccctcatggatgacctcttgtgcacaatagtcattcagccaacctcgggc
tatgtagagaacatttctccagcaccaggctcagaaaaatcaagggctgggattgccata
agtgccttcacgctgaaggatctcaggcaaggacacattaactatgtccagagtgtccac
agaggggtggagcctgtggaagaccgctttatattccgttgttctgacggcattaacttt
tctgagagacagattttccccattgtaatcattcctaccaacgatgagcagccagaaatg
ttcatgagggaattcatggtgatggaaggcatgagtctggtggtcgatacacccatcctc
aacgctgccgatgccgacattccccgggatgatttaacgttcaccattacccggtttccg
actcatggtcatatcatgaaccagctgatcaatggtacagtgttggttgaaagcttcacc
ttggaccagattatagagagttccagcattatttatgagcatgatgactctgagacacaa
gaggacagttttgtgattaagttgacagatggcaagcactctgtggagaagatggccctc
atcatggtcatccctgttgatgacgagacgcccagaatggccatcaataacgggctagaa
atagaaattggggaaaccaaagttatcaataacaaagttctagcggcaactgatttagac
tctgatgacaaatcactggtttatattattcggtatggaccggggcatggcttgttacag
agacggaagcctctaggtgtctttgaaaatatcacgctaggcatgaactttacccaggat
gaagtggacaggaacttaattcaatatgtccactttgggcaagagggcattcgagaccta
attaaattcgatgtgacagatgggacgaatgctctcatagaccgctacttctacgtgtct
attggaagtgttgacattgtcttccctgatgtggtaagtaagggcgtgtccttgaaagaa
ggtggcaaggtcactctgacaaccgacctgctaagcacaagcgacctgaacagtcctgat
gagaacttagttttcaccattaccagggctcccatgagaggtcacctggagtgcacggac
caaagaggactgtccatcacttctttcactcagctccagctggctggcaacaaaatctac
tacatacacacagccgaggatgaggtcaaaatggacagtttcgagtttcaagtcaccgac
ggccggaaccctgtcttccgaactttccggatctcaatcagcgacgtagacaacaaaaag
ccagtggtcaccatccacaacttggtggtcagtgaaagtgaaagtaagcttatcaccccc
tttgaactcaccgtggaagacagagatacccccgacaggctcctaaaattcatcgtcacc
caggtccctgttcatggtcacctcctcttcaacaacaccagatctgtcatggttttcacc
aagcaagacttgaatgaaaacttaatcagctacaaacacgatggcacagaatccacggaa
gacagcttctccttcacggtgactgacggcacccactcggacttctatgtttttcctgat
acagtgtttgagactaggagacctcaagtgatgaaaatccgggtgttacctgttgacaac
cgtgtcccccaaattgtagtgaacaaaggagcttctacacttcggactctgcccaccggc
catttggggttcatgatcacgagcaaaatattgaaagtgcaggacagagacagcctgcat
ttttctctcaggttcattgtgacagaagccccccaacatggctatcttctcaacctgggc
caaggaaaccacagtgtcacacagtttacccaagctgacattgacgacatgaaaatatgc
tatgtcttgagagagagagcaaatgccacgagcgatgtgttccatttcatagtggaagat
gacggtggaaacaggttaaccaaccagcattttcgactgaattgggcatggatctctttt
gaaaaggagtattacctgatcaacgaagattccaaatttctggatattgttcttaaacgc
agaggatacttgggagaaacttcgtttataagtatcagcacaagggatgggactgcagaa
aaagacaaagacttcaagggtaaagctcagaaacaagtgcagttcaatccgggccaaacc
agggcctcgtggagagtgcggatcctgagcgatggggaacacgagcactccgagaccttc
caagtggttctctctgagccggtgctggcagtcctggagttcccggaagtgactacggtg
gagatcattgacccaggcgatgaatcaaccgtgttcattccccagtctgaatactcagtt
gaagaagatgtgagcgagctgttcattcccatcaggaggagtggagacatcagccaggag
ctgatggtgatctgctatacacagcaagggacagcaaccagcactgtgcggacatccgtg
ctgtcttactctgactacatctccaggcctgaggaccacagcagcgtgatccgctttgac
aaagatgaacgtgagaaaatgtgtcgtgtggtggtgattgatgactcgttgtacgaagag
gaagagactttccaggtccttttgagcatgcccatgggcgggaggatcggcaacaagttt
ccgggagccaatgtgaccatcctcacagacaaggatgatgagcctgccttctactttggg
gatacccagcattcggtggatgaaagtgctggctacgtggaggtgcaggtgtggaggacg
gggaccgacctcacgaagccttctagtgtcacggtgaggtcccggaaaacagaacctccc
tctgcagacgctggaacagattatgtgggaatcagtcgcaatttagacttcgcacctggc
gtcagcatgcagaccgttcgcgttgtcatcctcgatgacctgggacgaccagtgctggag
ggaatcgagaagtttgaactggtacttcgaatgcctatgaacgctgcccttggcgaaccc
agcaaggccaccgtgtccataaatgactctgcctcagacttgcccaaaatgcaattcaaa
gaaagagtgtacacttgcagcgaaaatgatggacacgtggttgcaatgatctacaggagt
ggtgacctccagcacaggtcttctgtgagatgctacacgaggcaggggtctgcccaggtg
atgatggattttgaagaacgcccaaataccgacatttccattgtcacattcctccctggt
gagtcggagaagccgtgtgtccttgaactgatggacgatgatctctatgaggacgtggag
gagctgcgcctggtcctcggcacaccacagggcagctctgcctttggagctgcagtgggc
gagcagaacgaaaccctgataaagatccaggatgatgctgacaaagctgttatcaaattt
ggagaaaccaaatttagtgtcactgaacccagcagaccaggagagtcggtggttgtcaaa
attccggtgatccgccaaggagacacttcgaaggtttccatcgtgagagtgcacaccaag
gatggctcggctacctctggagaggattaccaccctgtgtcggaagaaatcgagtttaag
gaaggggaaacgcaacacactgttgaaattgaagtaatcttcgatggggtgagagagatg
agagaggctttcactgttcaccttaaaccggatgaaaatatggtagcagagacacagaca
accaaggccattgtatatatagaagaaatcaacagcatggcagatgtcacctttccttct
gtccctcacattgtgtccttgatggtatatgatgacactttcaaaggcagagaggacgct
ggacctgtttctggctatcctatcatctgcattacggcctgcaaccccaaatatccagac
tatgacaaaacaggctctatttgtgccagtgagaacatcaacgacactctgacccgatac
agatggctgaccagtgctcccactggcccggatggtgtagccagccctatgagagaggtg
gacttcgacaccttcttcacatcatccaagatgatcacactagactccatatactttcag
ccaggctctcgggtacagtgtgcggcccgagcagtgaacaccaatgggaacgaaggcctg
gaactaatgagccccatcgtcaccattgccagagaggaaggtctctgtcagccccgtgtg
cctggggtagtgggggcagagccgttctcagcaaagttgcgctacactggcccggaggac
ccagactttgccaacctcatcaagctcacggtcacgatgccacacatagacggcatgctc
ccggtcatctccacgagagagctgtccaactttgagctgacgctcagcccagatggcaca
agagttgggaatcacaaatgctccaacctgctggactacagtgaagtgaggacccaccat
ggcttcctgactaatgccacgaagaacccggaggtcattggagagacctatccttaccag
tacagtgcgccggtcaggggttccagcaccttacgcttctaccgaaacctgaacctggag
gcctgtctgtgggagtttgtcagctactacgacatgtcggagctcctggctgactgtgga
ggaaccatcgggaccgatggccaggtcctcaacctcgtgcagtcctacgtgacccttcga
gttcctctgtatgtttcctacgtgttccactcccccgtgggcgtgggaggctggcagcat
ttcgacttgaagtccgagctccggctcacattcgtgtacgacactgccatcttgtggaac
catgggatcggcagccccccggaagctgaactgcaaggctctctctatccaaccagcatg
cgcattggtgaggagggacgcctggctgtgaacttcaagacagaagctcagttccacggc
ttgtttgtgctgtcccatcctgcttccttcaccagctcattgattgtgtcagctgaccat
ccgggcctcacattttccctccgccttatacggagtgaaccaacctacaatcagccagtc
cagcagtggagtttcatctcagactttgcagttcgtgactactcgggcacctacacagta
aagctggtgccttgcaccaccccatccaaccaggagtaccgtttgccggtcacctgcaac
cccagagagcctgtcacctttgaccttgacattcgattccaacaggtcagcgaccccgtg
gcagctgagttcagcctgaacacccacatgtatctgctgtctaagaagagtctctggttg
tctgatgggtccatgggatttgggcaggagagcgatgttgcctttgcagaaggggacgtg
atttatggtcgtgtcatggtggatcctgtccagaaccttggtgactccttttactgcagc
attgagaaggtgttcttatgcacgggggatgatggctacgtgcccaagtacagcccggca
aatgcagaatatggctgcctggctgattctccttcactcttacatagattcaaaattgtg
gataaggctcagccagagacacaagccacaagctttggagatgtcctgtttaacgccaaa
ctggcggtggatgaccctgaagcagctctcttagtgaatcagcctggatcagatggtttt
aaagtagactcaacgccactctttcaggttgccttgggccgagaatggtacatacacaca
atctatacggtgaggtcaaagggcacctcccatcgaggcatcggcaagaggagcctggag
taccagtatcactctgtggtgcagcacggaccgccccaggcaactaccaagagctggaag
aagagagcagtcaggagcacgccctcactcgcaggggaaatcggtgccgagaacaatcga
ggaacaaatatccaacacatctccctggaccgccgtggcaagaggcaggtcccccatgga
agaattcctcctgacggcatcctgccctgggagctcaatagtcccagctctgaaatgagc
cttgtcactgtcctgggaggcatctcggtgggtttgcttgctgtctgcttggctgtggcc
gtggcagtcatgtgcaggaaccggagtatcaagggcaaggatgctccaaagggctctggg
agcactgagcccatgatgtccccgcagagccactacaatgacagctcagaggtgtga

DBGET integrated database retrieval system