KEGG   Rattus norvegicus (rat): 310537
Entry
310537            CDS       T01003                                 

Definition
(RefSeq) RGD1560010
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: RCDG1
Other DBs
NCBI-GeneID: 310537
NCBI-ProteinID: NP_001101155
RGD: 1560010
Ensembl: ENSRNOG00000010071
UniProt: B1WC95
Position
2q33
AA seq 111 aa
MADSEEFRASSPPPPPPSSPSSGASSSSLSMPVSLGWRGPSRSHGPTVDPLEQVELQIGD
AAFSLTKLLEATSAVSAQVEELALKCTENARFLKTWRDLLKEGYDSLKPDN
NT seq 336 nt   +upstreamnt  +downstreamnt
atggctgattctgaggagtttcgggcttcttcgccaccgccgccgcctccctcgtctccg
tcgtcaggcgcctcttcatcgtccctcagcatgccagtgagtttgggctggcggggtccg
agccggagccacggtccaacggtggacccgctggagcaagtggagctgcagatcggagat
gcggcattttcattaactaaactcctcgaagccacatctgcagtatcagctcaagtggaa
gaacttgccctgaagtgtacagaaaatgcacgtttccttaaaacgtggcgagacctcctg
aaagaaggctatgactcgctgaaacccgacaactaa

DBGET integrated database retrieval system