KEGG   Rattus norvegicus (rat): 310553
Entry
310553            CDS       T01003                                 

Gene name
Tlr2
Definition
(RefSeq) toll-like receptor 2 precursor
  KO
K10159  toll-like receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno05132  Salmonella infection
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    310553 (Tlr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    310553 (Tlr2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    310553 (Tlr2)
   04620 Toll-like receptor signaling pathway
    310553 (Tlr2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    310553 (Tlr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    310553 (Tlr2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    310553 (Tlr2)
   05161 Hepatitis B
    310553 (Tlr2)
   05171 Coronavirus disease - COVID-19
    310553 (Tlr2)
   05162 Measles
    310553 (Tlr2)
   05168 Herpes simplex virus 1 infection
    310553 (Tlr2)
   05169 Epstein-Barr virus infection
    310553 (Tlr2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    310553 (Tlr2)
   05134 Legionellosis
    310553 (Tlr2)
   05152 Tuberculosis
    310553 (Tlr2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    310553 (Tlr2)
   05144 Malaria
    310553 (Tlr2)
   05145 Toxoplasmosis
    310553 (Tlr2)
   05140 Leishmaniasis
    310553 (Tlr2)
   05142 Chagas disease
    310553 (Tlr2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    310553 (Tlr2)
   05321 Inflammatory bowel disease
    310553 (Tlr2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    310553 (Tlr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310553 (Tlr2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    310553 (Tlr2)
   04054 Pattern recognition receptors [BR:rno04054]
    310553 (Tlr2)
   04090 CD molecules [BR:rno04090]
    310553 (Tlr2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    310553 (Tlr2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    310553 (Tlr2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   310553 (Tlr2)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   310553 (Tlr2)
CD molecules [BR:rno04090]
 Proteins
  310553 (Tlr2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Cell surface receptors
   310553 (Tlr2)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR TIR_2 LRR_5 LRR_1 LRR_9 LRRCT PhoR
Other DBs
NCBI-GeneID: 310553
NCBI-ProteinID: NP_942064
RGD: 735138
Ensembl: ENSRNOG00000009822
UniProt: Q6YGU2
Position
2
AA seq 784 aa
MLQALWLFWILMAVIGLSREGHSAQASLSCDAAGVCDGSSRSFTSIPSGLTANTKKLDLS
FNKITYIGHGDLRACVNLRVLTLESSGINTIEGDAFYSLGSLEHLDLSNNHLSSLSSSWF
RPLSSLKYLNLMGNPYRTLGETSLFSNLTNLQTLRVGNVDTFSEIRRIDFAGLTSLNELE
IQVLSLGNYESRSLQSIRDIYHLTLHLSESAFLLGIFADILSSVRYLELRDTNLARFQFS
ELSVDEINSPMKKLAFRNADLTDKSFNELLKLLRYILELMEVEFDHCTLNGVGNFNPSES
DVVRELGKVETVTIRSLHIPQFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLK
SLEFLDLSENLMVEEYLKNSACEGGWPSLQSLVLSQNHLRSIRKTAEILLTLKNLTALDI
SKNSFQPMPDSCQWPGKMRFLNLSSTGIQAVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQ
ELYISRNKLKTLPEASLFPVLQVMKIRENAISTFSKDQLGSFPKLETLEAGDNHFICSCE
LLSFILERPALVHVLVDWPDSYLCDSPPRLHGQRLQDARPSVLECHQAALVSGVCCALLL
LILLLGALCYHFHGLWYLRMMWAWLRAKRKPKKAPCRDLCYDAFVSYSEQDSYWVENLMV
QQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLSENFVRSEWCKYELDFS
HFRLFDENNDAAILVLLEPIEKKAIPQRFCKLRKIMNTKTYLEWPLDEGQREVFWANLRT
AIKS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgctgcaagctctttggctcttctggatcttgatggctgtgataggcctctcaagggaa
ggccattctgcccaggcatctctgtcatgtgatgctgctggtgtgtgtgatggcagctcc
aggtctttcacctctattccctcgggactcacagcaaacacaaagaagcttgacctgtct
ttcaacaagatcacctacattggccatggtgacttgcgagcctgtgtgaacctccgggtt
ctgacattggagtccagcggaatcaacacaatagagggagatgccttttattctctgggc
agtcttgaacacttggacttgtctaataatcacctatctagtttatcttcctcctggttc
aggcccctttcctctttgaaatacttaaacttaatgggaaatccttacaggacactgggg
gaaacatcactgttctccaatctcacaaatttacaaacccttagggtaggaaatgttgac
actttcagtgagataaggagaatagattttgctgggctgacctctctcaacgaacttgaa
attcaggtattaagtctcggcaactatgagtcccgaagtctacagtcaattagagacatc
tatcacctgaccctgcacttgagcgagtctgctttcctgctggggatttttgcagatatt
ctgagttccgtgagatatttagaactaagagatactaacttggctaggttccaattttct
gaactgtctgtagacgaaatcaattcgccaatgaagaagctggcattccggaatgcagat
ctcaccgataaaagttttaatgaactcctgaagctgttgcgttacatcttggaactgatg
gaggtggagtttgatcactgcaccctcaatggggttggtaatttcaacccctcagagtca
gacgtagtgagggagctaggtaaagtagaaacggtaacaatacggagcctgcacatcccc
cagttctatttgttctatgatctgagcactgtgtattccctcctggagaaagtgaagcga
atcacagtagagaacagtaaggtctttctggttccctgctctttctcacagcatttaaaa
tcattagagttcttagacctcagcgaaaatctgatggttgaagagtatttgaaaaactca
gcctgtgagggtggctggccttctctacaaagcttggttttgagtcagaatcatttgaga
tcaatacgaaaaactgctgagattttgctgactctgaaaaacctgacagcccttgacatc
agcaagaacagttttcagcctatgcccgacagttgtcagtggccaggaaagatgcgcttc
ctgaacttgtccagtacagggatacaggccgtcaagacatgcattcctcagaccctggag
gtgttggatgttagtaacaacaatctcgattcattttctttgtttttgcctcggctccaa
gagctgtatatttccagaaataaactgaagacactcccagaagcttcattgttccctgtg
ttacaggtcatgaagatcagagagaacgcaataagtactttctctaaagaccagcttggt
tcttttcccaaactggagactctggaagcaggtgacaaccatttcatctgctcctgtgaa
ctcctgtccttcattctggagaggccagccctggtccatgtcctggttgactggccagac
agctacctgtgtgattctccgcctcgcctgcatggccagaggcttcaggatgcccggccc
tcagtcttggagtgtcaccaggccgcactggtctctggagtctgctgtgcccttctcctg
ttgatcctgctcttaggcgccctgtgttaccatttccatgggctgtggtatctgagaatg
atgtgggcgtggctccgggccaagaggaagcccaagaaagctccttgcagggacctttgc
tatgatgcctttgtttcctacagcgagcaggattcctattgggtggagaacctcatggtc
cagcagctggagaactctgacccacccttcaagctgtgtctccacaagcgggactttgtt
ccgggcaaatggatcattgacaacatcattgattccatcgaaaagagccacaaaactgtg
ttcgtgctttctgagaacttcgtacgcagtgagtggtgcaagtatgaactggacttctcc
cacttcaggctctttgacgagaacaatgacgcggccatccttgttttgctggaacccatt
gagaagaaagccattccccagcgcttctgcaaactgcgcaagataatgaacactaagaca
tacctggagtggcccttggatgaaggccagcgggaagtgttttgggcaaatctgagaact
gcaataaaatcctag

DBGET integrated database retrieval system