KEGG   Rattus norvegicus (rat): 310615Help
Entry
310615            CDS       T01003                                 

Gene name
Crtc2, RGD1308903, Torc2
Definition
(RefSeq) CREB regulated transcription coactivator 2
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    310615 (Crtc2)
   04152 AMPK signaling pathway
    310615 (Crtc2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    310615 (Crtc2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    310615 (Crtc2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    310615 (Crtc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TORC_M TORC_C TORC_N
Motif
Other DBs
NCBI-GeneID: 310615
NCBI-ProteinID: NP_001029067
RGD: 1308903
Ensembl: ENSRNOG00000056337
UniProt: Q3LRZ1 B4F7E3
Position
2q34
AA seq 691 aa AA seqDB search
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGCGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YPRHIDSSPYSPAYLSPPPESGWRRMMPWGNLPAEKGQLFRLPSALNRTSSDSALHTSVM
NPNPQDTYPGPTPPSVLPSRRGGFLDGEMDAKVPAIEENLVDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPANVPVLPPAMSTGGSLPDLTNLHFPPPLPTPLDPEETVYPS
LSGGNSTTNLTHTMTHLGISGGLGLGPSYDVPGLHSPLSHPSLQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLAHHALPTTSLGHPSLSAPALSSSSSSSSTSSPVLSAPPYPAST
PGASPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLPTD
QRLPPYPYSPPSLVIPSHPPTPKSLQQLPSQACLVQPSGGQPPGRQPHYGTLYPPGSSGH
GQQPYHRPINDFSLGNLEQFNMESPSTSLVLDPPAFSEGPGFLGSEGSVSGPQDSHVLNH
QNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSASGLELGLGLEDELRMEP
LGLEGLTMLSDPCALLPDPAVEDSFRSDRLQ
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtcaggggcgaacgggccgggttccgccacagcctcggcgtccaatccacgc
aagtttagtgaaaagatcgcgctgcagaagcagcgtcaggccgaggagacggcggccttt
gaggaggtgatgatggacatcggctccactcggttacaggcccaaaagctgcgactggct
tatacaaggagctcccattatggtggttctctgcccaatgttaaccagattggctgtggc
ctggctgagttccagagcccccttcattcacctttggattcatctcggagcactcggcac
catggattggtggaacgggtacaacgagaccctcgcagaatggtgtccccactccgccga
tacccccgccacattgacagttctccctatagccctgcctacttatctcctccccctgag
tctggctggcgaaggatgatgccctggggcaacctcccagctgagaaggggcagttgttt
agactgccatctgcacttaacaggacaagctctgactctgctcttcacacaagtgtgatg
aaccctaacccccaagacacttatccaggccctacacctcccagtgtcctgcccagccgg
cgaggaggttttctggatggcgagatggatgctaaagtccctgctattgaggagaacttg
gtagatgacaagcatttgctgaaaccttgggatgctaagaagctgtcctcatcttcctct
cgacctcgatcctgtgaagtccctggaatcaacatctttccatctcctgaccagcctgct
aatgtgcctgtcctcccacctgccatgagcacagggggctccctacctgacctcaccaac
ctacacttcccccctccactgcccacgcccctggaccctgaggagacagtctatcccagc
ctgagtgggggcaacagtaccaccaatttgactcacactatgacccatttgggcatcagt
ggaggtctgggcttgggccccagctatgatgtaccaggacttcactcacctcttagccac
ccgtccctgcagtcctccctaagcaatcccaacctccaggcttccctaagcagtcctcag
ccccagctccagggctcccatagtcacccatcactgcctgcctcctccttggcccaccat
gcactgcccaccacctccctgggccacccgtcacttagtgccccagccctttcctcctcc
tcttcctcttcgtccacttcatctcctgtcctgagtgcccccccttacccagcttctact
cctggggcctctccccgccaccgtcgtgtgcccctcagccccctgagcttgcctgcaggc
ccagccgacgccagaaggtcccaacagcagctgcccaaacagttttcgccaacaatgtca
cccaccttgtcttccatcactcagggcgtccccttggataccagtaaactgcctactgac
cagcgattgcccccatacccatatagccccccaagtctagttatacccagccatccaccc
accccaaagtctctacagcagttgccctctcaggcctgcttagtacagccctcaggtgga
cagcctccaggcaggcagccacattatgggacactgtacccacctgggtccagtggacat
gggcaacagccttaccaccgcccaataaatgacttcagcctggggaatctggagcaattc
aacatggagagcccatctaccagcctggtgctggatccccctgccttttctgaaggtcct
ggatttttagggagtgagggatcagtgagtggcccccaggactctcatgtcctcaatcac
cagaacttgacccactgttcccgccatggctcaggacctaatatcatactcacaggagac
tcttccccaggtttctctaaggagattgcagcagccctggctggagtacctggctttgag
gtgtcagcatctgggttggagctgggactggggctggaagatgagttgcgcatggagcca
ctgggcctggaaggactaaccatgctgagtgacccttgtgctctgctgcctgaccctgct
gtggaagactcattccgtagtgatcggctacagtga

DBGET integrated database retrieval system