KEGG   Rattus norvegicus (rat): 310616
Entry
310616            CDS       T01003                                 

Gene name
Creb3l4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    310616 (Creb3l4)
   04024 cAMP signaling pathway
    310616 (Creb3l4)
   04022 cGMP-PKG signaling pathway
    310616 (Creb3l4)
   04151 PI3K-Akt signaling pathway
    310616 (Creb3l4)
   04152 AMPK signaling pathway
    310616 (Creb3l4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    310616 (Creb3l4)
   04922 Glucagon signaling pathway
    310616 (Creb3l4)
   04915 Estrogen signaling pathway
    310616 (Creb3l4)
   04926 Relaxin signaling pathway
    310616 (Creb3l4)
   04935 Growth hormone synthesis, secretion and action
    310616 (Creb3l4)
   04918 Thyroid hormone synthesis
    310616 (Creb3l4)
   04928 Parathyroid hormone synthesis, secretion and action
    310616 (Creb3l4)
   04916 Melanogenesis
    310616 (Creb3l4)
   04925 Aldosterone synthesis and secretion
    310616 (Creb3l4)
   04927 Cortisol synthesis and secretion
    310616 (Creb3l4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    310616 (Creb3l4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    310616 (Creb3l4)
  09156 Nervous system
   04725 Cholinergic synapse
    310616 (Creb3l4)
   04728 Dopaminergic synapse
    310616 (Creb3l4)
  09149 Aging
   04211 Longevity regulating pathway
    310616 (Creb3l4)
  09159 Environmental adaptation
   04714 Thermogenesis
    310616 (Creb3l4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    310616 (Creb3l4)
  09162 Cancer: specific types
   05215 Prostate cancer
    310616 (Creb3l4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    310616 (Creb3l4)
   05161 Hepatitis B
    310616 (Creb3l4)
   05163 Human cytomegalovirus infection
    310616 (Creb3l4)
   05165 Human papillomavirus infection
    310616 (Creb3l4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    310616 (Creb3l4)
   05020 Prion disease
    310616 (Creb3l4)
  09165 Substance dependence
   05030 Cocaine addiction
    310616 (Creb3l4)
   05031 Amphetamine addiction
    310616 (Creb3l4)
   05034 Alcoholism
    310616 (Creb3l4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    310616 (Creb3l4)
   04934 Cushing syndrome
    310616 (Creb3l4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    310616 (Creb3l4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    310616 (Creb3l4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB KASH_CCD Spc29 DUF4407 CASP_C DUF2207 EMP24_GP25L ATG16 DUF6118 HAUS-augmin3 Jnk-SapK_ap_N YabA ADIP DMPK_coil
Other DBs
NCBI-GeneID: 310616
NCBI-ProteinID: NP_001007094
RGD: 1359278
Ensembl: ENSRNOG00000023493
UniProt: Q5UEM7
Position
2
AA seq 367 aa
MELGCPELLEPPEDIFSTGSFLELGFNGPPSKVPGLQKSESDDFLNLFIDPNMIRCSETS
PGSDSGVSEDPGSPAPQAPSSPALYEVVYEAGALQGTQREAGPTFGLISIQIDQWSPAFM
VPGACTVSDLPSEAHRHILPRVSTIAPPPPAALLSCQRLFLTDEEKHLLGQEGVTLPSHL
PLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSEQNQKLQRKVQELER
QNISLVAQVHQLQKFTAQTSSRAAQTSTCVLILLFSLALIILPSFSPFQSQPEARSEGYQ
LHGVISRNILTHEDMTESPESPVLKANLEELPQVPATNGSTKMAHLKMRVKARPTGPIRG
MVHADEM
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagctcgggtgccctgagttgctggaacccccagaagatatcttctcgacaggatct
ttcctggagctgggatttaatggtcccccgtcaaaggtgccgggccttcagaagagcgag
tctgatgatttcctgaacctctttatcgatcccaatatgatacgctgctcagaaacatct
cctggtagtgacagtggggtctctgaagatcctggctcccctgccccacaggcacccagt
tccccagccctctatgaagttgtctatgaggcaggagccctacagggaacccagcgggaa
gctgggccaaccttcggactcatctccatccagatagatcagtggagccctgcatttatg
gtacctggtgcctgcacagtcagtgatctgccctctgaagctcatagacacatcctgcct
agagtcagcaccatagccccaccacctcctgcagccctgctgtcctgccaacgtctgttc
ctgacagatgaagaaaagcatctgctgggacaagaaggggttactctgccctctcacctg
cccctcaccaaggcagaggagagaatactcaagaagatcaggaggaaaatccgcaacaag
cagtcagctcaggacagccggcggaggaagaaagaatacatagatgggctggagagcaga
gtggcagcctgttctgagcagaaccagaaactgcagagaaaggtccaggagctggagagg
cagaacatctcgttggtggcgcaggtccatcagttacagaagttcactgctcagacctcc
agcagagctgcccagaccagcacctgtgttctgattcttcttttttcgttggctctcatc
atcctgcccagcttcagcccctttcagagtcaaccagaagctaggtctgagggttatcag
cttcatggagtcatttccagaaatatcttgactcatgaggacatgacagaaagcccggag
agtccagtgctaaaggccaacctggaggagctacctcaagtcccagccacaaatggctca
acaaagatggctcatctgaagatgcgagtgaaggccagacccactgggccgatcagggga
atggtgcatgcagatgagatgtaa

KEGG   Rattus norvegicus (rat): 314638
Entry
314638            CDS       T01003                                 

Gene name
Creb3l3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    314638 (Creb3l3)
   04024 cAMP signaling pathway
    314638 (Creb3l3)
   04022 cGMP-PKG signaling pathway
    314638 (Creb3l3)
   04151 PI3K-Akt signaling pathway
    314638 (Creb3l3)
   04152 AMPK signaling pathway
    314638 (Creb3l3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    314638 (Creb3l3)
   04922 Glucagon signaling pathway
    314638 (Creb3l3)
   04915 Estrogen signaling pathway
    314638 (Creb3l3)
   04926 Relaxin signaling pathway
    314638 (Creb3l3)
   04935 Growth hormone synthesis, secretion and action
    314638 (Creb3l3)
   04918 Thyroid hormone synthesis
    314638 (Creb3l3)
   04928 Parathyroid hormone synthesis, secretion and action
    314638 (Creb3l3)
   04916 Melanogenesis
    314638 (Creb3l3)
   04925 Aldosterone synthesis and secretion
    314638 (Creb3l3)
   04927 Cortisol synthesis and secretion
    314638 (Creb3l3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    314638 (Creb3l3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    314638 (Creb3l3)
  09156 Nervous system
   04725 Cholinergic synapse
    314638 (Creb3l3)
   04728 Dopaminergic synapse
    314638 (Creb3l3)
  09149 Aging
   04211 Longevity regulating pathway
    314638 (Creb3l3)
  09159 Environmental adaptation
   04714 Thermogenesis
    314638 (Creb3l3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    314638 (Creb3l3)
  09162 Cancer: specific types
   05215 Prostate cancer
    314638 (Creb3l3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    314638 (Creb3l3)
   05161 Hepatitis B
    314638 (Creb3l3)
   05163 Human cytomegalovirus infection
    314638 (Creb3l3)
   05165 Human papillomavirus infection
    314638 (Creb3l3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    314638 (Creb3l3)
   05020 Prion disease
    314638 (Creb3l3)
  09165 Substance dependence
   05030 Cocaine addiction
    314638 (Creb3l3)
   05031 Amphetamine addiction
    314638 (Creb3l3)
   05034 Alcoholism
    314638 (Creb3l3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    314638 (Creb3l3)
   04934 Cushing syndrome
    314638 (Creb3l3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    314638 (Creb3l3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    314638 (Creb3l3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Spc29 DUF1664 ADIP
Other DBs
NCBI-GeneID: 314638
NCBI-ProteinID: NP_001012115
RGD: 1308152
Ensembl: ENSRNOG00000032202
UniProt: Q5FVM5
Position
7
AA seq 470 aa
MDGDISTGKMASPACAMAPLDSMEVLDLLFDGQDGILRNVDLAESWILTREEQKVLPNSD
SDEFLNSILGPGDSDPSSPIWSPADSDSGISEDLPSDSQDTPPGSGPGSANVAARCHPSK
QGEGPCPSYLPSTACPEPPRTQVHESSVAIDLDMWSTDTLYPEEQAGSPSRFNLTVKELL
LSGGGGDLQQHPLAASQLLGPGSGHCQELVLTEDEKKLLAKEGVTLPTQLPLTKYEERVL
KKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNLSLLEQLK
HLQALVVQSTSKPAHAGTCIAVLLLSFVLIILPSISPFTANKVDSPGDFIPVRVFSRTLH
NHAASRVAPDVTPGPEVPGPHKGSSGGLSADWGNFLEIPMLDDPTEELDNTTLVLANSTE
DLGRATLLDWVASEPLLGQMGLEIPGEEIWLSWVPRWLRVRVVQDALGVL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggatggggacatatcgacgggaaagatggcgtcccctgcctgtgccatggctccctta
gatagcatggaagtccttgacctcctgttcgacgggcaggatggcatcctgagaaatgta
gacctggctgagagctggatcctcaccagagaggaacagaaagttctaccaaattctgac
tctgatgaattcctaaattccatcctgggacctggagactctgaccccagctccccaata
tggtccccagctgacagtgacagcggcatctctgaggatctaccttccgattcccaggac
acccctcctggtagtggacctggatccgctaacgttgcagccaggtgtcatccaagcaag
caaggcgaggggccctgcccctcctaccttcctagcacagcatgccctgagcctccaagg
acacaagtccatgagtcctcggtggccattgacctggacatgtggagcacagacaccctg
tacccggaggagcaggctggctcgccctcccgcttcaacctcactgtgaaggaattgctg
ctgtctggtggtggcggggacttgcaacagcatcccttggccgcctcccagctgctggga
cctgggagtgggcactgccaggagctggtactgacagaggatgagaagaagttgctggct
aaagagggggtgacccttcccacccagctgcccctcaccaagtatgaggaacgggtgttg
aaaaaaatccgcagaaagatccggaacaaacagtcagctcaagaaagcagaaagaagaaa
aaagaatacatcgatggtttggagaaccggatgtcagcgtgtaccgcccagaaccaggag
ctgcagaggaaggtcttgcacttagaaaagcaaaatttgtctcttctggagcagctcaaa
cacctgcaggctcttgtggtccagtcaaccagcaagcctgcccatgcaggcacctgcata
gcggtccttctgctgtccttcgtcctgatcatcctcccttccatcagccctttcactgcc
aacaaagtcgacagccctggtgacttcattccagtgcgagtgttttccagaaccctgcac
aaccatgctgcatcccgcgtggctcccgacgtcaccccaggacccgaggtcccaggaccc
cacaaaggctcttctggcggcctcagtgcagactgggggaattttctagaaattccaatg
ttggatgacccaacagaagagttagacaacaccaccctggtgctggccaactccacagag
gacctgggacgggccactctgctggactgggtggcttcagaaccactgcttggccagatg
gggctggagataccaggggaggagatatggctgtcctgggtaccgaggtggctcagggtc
cgtgtggtgcaagatgctttgggggtgctatga

KEGG   Rattus norvegicus (rat): 362165
Entry
362165            CDS       T01003                                 

Gene name
Creb3l1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    362165 (Creb3l1)
   04024 cAMP signaling pathway
    362165 (Creb3l1)
   04022 cGMP-PKG signaling pathway
    362165 (Creb3l1)
   04151 PI3K-Akt signaling pathway
    362165 (Creb3l1)
   04152 AMPK signaling pathway
    362165 (Creb3l1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    362165 (Creb3l1)
   04922 Glucagon signaling pathway
    362165 (Creb3l1)
   04915 Estrogen signaling pathway
    362165 (Creb3l1)
   04926 Relaxin signaling pathway
    362165 (Creb3l1)
   04935 Growth hormone synthesis, secretion and action
    362165 (Creb3l1)
   04918 Thyroid hormone synthesis
    362165 (Creb3l1)
   04928 Parathyroid hormone synthesis, secretion and action
    362165 (Creb3l1)
   04916 Melanogenesis
    362165 (Creb3l1)
   04925 Aldosterone synthesis and secretion
    362165 (Creb3l1)
   04927 Cortisol synthesis and secretion
    362165 (Creb3l1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    362165 (Creb3l1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    362165 (Creb3l1)
  09156 Nervous system
   04725 Cholinergic synapse
    362165 (Creb3l1)
   04728 Dopaminergic synapse
    362165 (Creb3l1)
  09149 Aging
   04211 Longevity regulating pathway
    362165 (Creb3l1)
  09159 Environmental adaptation
   04714 Thermogenesis
    362165 (Creb3l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    362165 (Creb3l1)
  09162 Cancer: specific types
   05215 Prostate cancer
    362165 (Creb3l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    362165 (Creb3l1)
   05161 Hepatitis B
    362165 (Creb3l1)
   05163 Human cytomegalovirus infection
    362165 (Creb3l1)
   05165 Human papillomavirus infection
    362165 (Creb3l1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    362165 (Creb3l1)
   05020 Prion disease
    362165 (Creb3l1)
  09165 Substance dependence
   05030 Cocaine addiction
    362165 (Creb3l1)
   05031 Amphetamine addiction
    362165 (Creb3l1)
   05034 Alcoholism
    362165 (Creb3l1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    362165 (Creb3l1)
   04934 Cushing syndrome
    362165 (Creb3l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362165 (Creb3l1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    362165 (Creb3l1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 TPR_MLP1_2 Jnk-SapK_ap_N DUF4337 ELP6 APG6_N ADIP RNase_Y_N JMY JIP_LZII
Other DBs
NCBI-GeneID: 362165
NCBI-ProteinID: NP_001005562
RGD: 1359613
Ensembl: ENSRNOG00000005413
UniProt: Q66HA2
Position
3
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFVENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPAPGIQAEHSYSLSGDSAPQSPLVPVKMEDTTQDMEHGAWALG
NKLCSIMVKQEQSPELPVDPLAASSAMAAATMATPPLLGLSPISRLPIPHQAPGEMTQLP
VIKAEPPEMSQFLKVTQEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTAI
STSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNK
ISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTLVTSKI
SRPYKMAATQTGTCLMVAALCFVLVLGSLAPCLPAFSSGSKTVKEDPVAADSVYAASQMP
SRSLLFYDDGAGSWEDGHRGALLPVEPPEGWELKPGGPAEPRPQDHLRHDHADSIHETTK
YLRETWPEDTEDNGASPNFSHPKEWFHDRDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggaacctttcccggccgacaggctgttcccgggatccagcttcctg
gacttgggagacctgaatgagtcggatttcctcaacaatgcgcacttcccggagcacctg
gaccactttgtggagaacatggaggacttctccaatgacctgttcagcagcttctttgat
gaccctgtgctggatgagaagagccctctgctggacatggaactggattcccctgctcca
ggcatccaggctgagcacagctactccctgagtggggattctgcaccccagagccccctt
gtgcctgtcaaaatggaggataccacccaagatatggaacacggagcatgggcactggga
aacaaactgtgctccattatggtgaagcaggagcagagcccggagcttccggttgacccc
ctggctgcctcctccgccatggctgctgctaccatggccaccccaccactgctgggcctc
agccccatctccaggctgcccatccctcaccaggccccaggagaaatgactcagctgcca
gtgatcaaagcagagcccccggaaatgagccagtttctcaaagtgacacaagaggacctc
gtacagatgcctccaacaccccccagcagccatggcagtgacagtgacggctcccagagt
ccccgctctcttcccccctccagccctgtccggcccatggcccgctcctccacggccatt
tccacctctccgctcctcactgcccctcacaaactgcaggggacatcagggccactgctc
ttgacagaagaggagaagcgaactttgatcgccgagggttatcccatccccaccaaactc
cccctcaccaaggctgaggagaaggccctgaagagagtgcgcaggaaaattaagaacaag
atctctgcccaggagagccgccgcaaaaagaaggagtatgtggagtgtctagagaagaag
gtggagacatatacatcagagaacaatgaactgtggaagaaggtggaaaccctagagact
gccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccagcaagatc
tccagaccttacaagatggcggccacacagactggcacttgcctcatggtggcagccttg
tgctttgttctggtgctgggctcacttgcgccctgccttcctgcattctcttctggctca
aagactgtgaaagaagaccccgtcgcagctgacagtgtctacgcagccagtcagatgcct
tcccgaagcctgctgttttatgatgatggggcaggctcctgggaagatggccaccgaggt
gctctactgcctgtggagcccccagaaggctgggagctcaaacccgggggaccagcagag
ccgaggccccaggaccacctccgacatgaccatgcggacagcatccacgagacaaccaag
tacttgagagagacctggccagaggataccgaggacaatggcgccagccccaatttctcc
caccccaaggagtggttccacgacagggatctgggccccaacaccaccatcaaactctcc
tag

KEGG   Rattus norvegicus (rat): 362339
Entry
362339            CDS       T01003                                 

Gene name
Creb3l2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    362339 (Creb3l2)
   04024 cAMP signaling pathway
    362339 (Creb3l2)
   04022 cGMP-PKG signaling pathway
    362339 (Creb3l2)
   04151 PI3K-Akt signaling pathway
    362339 (Creb3l2)
   04152 AMPK signaling pathway
    362339 (Creb3l2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    362339 (Creb3l2)
   04922 Glucagon signaling pathway
    362339 (Creb3l2)
   04915 Estrogen signaling pathway
    362339 (Creb3l2)
   04926 Relaxin signaling pathway
    362339 (Creb3l2)
   04935 Growth hormone synthesis, secretion and action
    362339 (Creb3l2)
   04918 Thyroid hormone synthesis
    362339 (Creb3l2)
   04928 Parathyroid hormone synthesis, secretion and action
    362339 (Creb3l2)
   04916 Melanogenesis
    362339 (Creb3l2)
   04925 Aldosterone synthesis and secretion
    362339 (Creb3l2)
   04927 Cortisol synthesis and secretion
    362339 (Creb3l2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    362339 (Creb3l2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    362339 (Creb3l2)
  09156 Nervous system
   04725 Cholinergic synapse
    362339 (Creb3l2)
   04728 Dopaminergic synapse
    362339 (Creb3l2)
  09149 Aging
   04211 Longevity regulating pathway
    362339 (Creb3l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    362339 (Creb3l2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    362339 (Creb3l2)
  09162 Cancer: specific types
   05215 Prostate cancer
    362339 (Creb3l2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    362339 (Creb3l2)
   05161 Hepatitis B
    362339 (Creb3l2)
   05163 Human cytomegalovirus infection
    362339 (Creb3l2)
   05165 Human papillomavirus infection
    362339 (Creb3l2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    362339 (Creb3l2)
   05020 Prion disease
    362339 (Creb3l2)
  09165 Substance dependence
   05030 Cocaine addiction
    362339 (Creb3l2)
   05031 Amphetamine addiction
    362339 (Creb3l2)
   05034 Alcoholism
    362339 (Creb3l2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    362339 (Creb3l2)
   04934 Cushing syndrome
    362339 (Creb3l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362339 (Creb3l2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    362339 (Creb3l2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Phage_GPO JMY HAUS6_N TPR_MLP1_2
Other DBs
NCBI-GeneID: 362339
NCBI-ProteinID: NP_001012188
RGD: 1306040
Ensembl: ENSRNOG00000012826
UniProt: Q6QDP7
Position
4
AA seq 521 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLSEEPRAQSPFTHVAASDGFNDEEVESEKWYLSTEF
PSATIKTEPITEEQPPGLVPSVTLTITAISTPFEKEESPLDMSAGGDSSCQTLIPKIKLE
PHEVDQFLNFSPKEASVDQLHLPPTPPSSHSSDSEGSLSPNPRLHPFSLSQAHSPGRAMP
RGPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSLFQGYGLYPSATKMALPSQHPLSEPYT
ASVVRSRNLLIYEEHSSLEESSSPASAGELGGWDRGSSLLRASSGLEALPEVDLPHFIIS
KETSLEKSVLLELQQHLVSSKLEGNETLKVVELERRVNATF
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagtgtcctgcagtgggaccgcaagctgagcgag
ctgtcagaacccggagagactgaggctctcatgtaccacacgcacttctcagagctcctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgaccctttcctctcagagaag
agcgtgtccatggaggtggagccatctcccacatcaccagcacctctcatccaggctgaa
cacagctactctctgagcgaggagccccgggctcagtcaccatttacccacgtggctgcc
agcgatggcttcaatgacgaggaggtggagagtgagaaatggtacctgtctacagagttt
ccttcagctaccatcaagacagagcccatcacagaggagcagcccccaggacttgtccct
tctgtcactctgaccatcacagccatttccactccgtttgaaaaagaagagtcccctctg
gatatgagtgctgggggagactcctcatgccagacacttattcctaagattaagctggag
ccgcatgaagtggatcaattcttaaacttctctccgaaagaggcctccgtggaccagctg
cacttaccacccacaccacccagtagtcacagcagtgactctgagggcagcttgagcccc
aacccacgtctgcatcccttcagcctctctcaggcccacagccccggcagagccatgccc
cggggcccctctgccttgtccacatctcctctcctcacagctccacataaactgcagggg
tcgggcccactggtcctgacagaggaagagaagaggaccttgattgccgagggctatccc
attccaaccaaactgcccctgacaaaatctgaggagaaggccctgaagaaaatccggaga
aagatcaagaataagatttctgcccaagaaagcaggaggaagaagaaagaatacatggat
agcttggagaaaaaagtggagtcttgttcaaccgagaacttggagcttcggaagaaggtg
gaggtgctggagaacaccaacaggactctccttcagcaacttcagaagcttcagactttg
gtgatggggaaggtctctcgaacctgcaagttagctggtacacagactggcacctgcctc
atggtcgttgtgctttgctttgcggttgcatttggcagcctctttcaaggctacgggctg
tatccttctgccaccaagatggctctgcccagccagcaccccctgtcggagccatacaca
gcctccgtggtgagatccaggaacctgctaatctatgaggaacactcttccctggaagag
tcgtccagcccagcctcggctggagagctcgggggctgggacagaggctcctctctgctc
agggcgtcgtccgggttggaggccctgcccgaggtggatcttccccatttcattatctcc
aaggagaccagcttggagaagtcagtgctgttggagcttcagcagcacctggtcagcagc
aaactagaggggaacgaaacactcaaggttgtagaactggagaggagagtgaacgccacc
ttctga

KEGG   Rattus norvegicus (rat): 406169
Entry
406169            CDS       T01003                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    406169 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    406169 (Atf6b)
   04022 cGMP-PKG signaling pathway
    406169 (Atf6b)
   04151 PI3K-Akt signaling pathway
    406169 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    406169 (Atf6b)
   04915 Estrogen signaling pathway
    406169 (Atf6b)
   04926 Relaxin signaling pathway
    406169 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    406169 (Atf6b)
   04918 Thyroid hormone synthesis
    406169 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    406169 (Atf6b)
   04925 Aldosterone synthesis and secretion
    406169 (Atf6b)
   04927 Cortisol synthesis and secretion
    406169 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    406169 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    406169 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    406169 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    406169 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    406169 (Atf6b)
   05161 Hepatitis B
    406169 (Atf6b)
   05163 Human cytomegalovirus infection
    406169 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    406169 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    406169 (Atf6b)
   05031 Amphetamine addiction
    406169 (Atf6b)
   05034 Alcoholism
    406169 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    406169 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    406169 (Atf6b)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    406169 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 bZIP_Maf GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 406169
NCBI-ProteinID: NP_001002809
RGD: 1303317
Ensembl: ENSRNOG00000000431
Vega: OTTRNOG00000001701
UniProt: Q4G097
Position
20
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTQLFRCVEQDVPFDSSSL
DVGMDVIPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQVPRVGEVLQ
VKMESLAPPLCLLGDDPAFPFETVQITVGSASDDLADIQTKLEPASPSSSVNSEASLLSA
DSPSQALIGEEVLEVKTESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGKAPAPRKPP
LQPKPVVLTTVPVPPRAGPASTAVLLQPLVQQPAVSPVVLIQGAIRAQPEGPAPAAPRPE
RKSIVPAPMPGNACPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPAP
VSRMSREGPRPQRHLLGFSEPGPAHGIEPLQEAAKGPEEQQPSPAGKPSFRNLTAFPSGA
KELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGHQRGRRKIPHRAQERQKS
QLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPGRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPAGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPSPGNTTGGPLPGSAASPARQASRQPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagatcgccgacccgacgcgcttcttcaccgacaac
ctgctgagtccggaggactgggacagcaccttgtacagtggcctggatgaagtggccgag
gagcagacgcagttgtttcgttgcgtggagcaggatgtcccgtttgacagcagctctctg
gatgtggggatggatgtcatcccccctgagcccccttgggaccctctacccatcttccca
gatcttcaggtgaagtctgagccgtcctctccctgctcctcttcctccctcagctcagaa
tcctcacatctttccacagagccctccagccaggttcctagagtaggggaggtgctgcag
gtaaagatggagtccctggcacccccgctctgcctgctgggagatgatccagcgttcccc
tttgaaacagtccagatcactgtgggctctgcctctgatgatctcgcagatatccagacc
aagctagaacccgcctctccgtcttcctctgtcaactccgaggcctccttgctgtcagca
gactctcccagccaggctcttataggagaggaggttctggaagtgaagacagagtctccg
tcccctccagggtgcctcctctgggatgtcccagcctcttcacttggagctgtccagatc
agcatgggtccgtcccctgatagttcctcagggaaagctcctgcccctcggaagcctcca
ctgcagcccaagcctgtggtgctaaccacagttccggtgccacctagagctgggcctgcc
agcactgctgtccttctgcagcccctggtccagcagcccgcagtatccccggtggttctc
atccaaggtgctatccgagcccagcctgaagggccagctccggcagcccctcggcctgag
aggaagagcattgtcccagcccctatgccggggaacgcctgcccgcctgaagtggacgcg
aagctgctaaagcgccagcagcggatgatcaagaaccgggagtcagcctgccagtcccgc
cgcaagaagaaggagtacctgcaaggcctggaggcccggctgcaggccgtgctggccgac
aaccagcagctgcgccgggagaatgctgccctccggcggcggctggaggccctactggca
gagaacagcgagctcaagctggggtctggaaacaggaaggttgtctgcatcatggtcttc
cttctcttcattgccttcaactttgggcctgtcagcatcagcgagccacctccagctccc
gtctctcggatgagcagggagggaccccgaccccagaggcacctgctggggttctcagaa
ccagggccagctcacggcatcgaacccctccaggaagctgccaagggccctgaggagcag
cagcccagccctgcaggcaagcccagcttcagaaacctgacagccttccccagtggggcc
aaggagctgctgctgagagacctggaccagctcttcctttcctctgactgccgccatttc
aaccgaactgagtctctgaggcttgctgatgagctgagtggctgggtccaacgtcaccag
agaggtcaccagagaggtcgtcggaagatacctcatagggcccaggagagacagaagtct
cagctacggaagaagtcccctccagtgaaaccagtccccacccaacctccaggaccccct
gaaagggaccccgtgggccagctgcagctctaccgccacccaggccgctcacagccggag
tttctagatgcaattgaccggagggaagataccttctatgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacatccaggcccaagatgtcgttggtg
atgccagccatggcccccaatgagaccgtgtcaggccgggggcccgctggggactatgag
gagatgatgcagattgagtgtgaagtcatggacaccagggtgattcacatcaagacctcc
acggtgcccccctcacttcggaagcagccgtccccgtccccaggcaataccacaggtggc
cccttgccaggctccgcagccagtccggcccgtcaggcctcccgccagcccctctacctc
aatcatccctga

KEGG   Rattus norvegicus (rat): 500131
Entry
500131            CDS       T01003                                 

Gene name
Creb5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    500131 (Creb5)
   04024 cAMP signaling pathway
    500131 (Creb5)
   04022 cGMP-PKG signaling pathway
    500131 (Creb5)
   04151 PI3K-Akt signaling pathway
    500131 (Creb5)
   04152 AMPK signaling pathway
    500131 (Creb5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    500131 (Creb5)
   04922 Glucagon signaling pathway
    500131 (Creb5)
   04915 Estrogen signaling pathway
    500131 (Creb5)
   04926 Relaxin signaling pathway
    500131 (Creb5)
   04935 Growth hormone synthesis, secretion and action
    500131 (Creb5)
   04918 Thyroid hormone synthesis
    500131 (Creb5)
   04928 Parathyroid hormone synthesis, secretion and action
    500131 (Creb5)
   04925 Aldosterone synthesis and secretion
    500131 (Creb5)
   04927 Cortisol synthesis and secretion
    500131 (Creb5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    500131 (Creb5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    500131 (Creb5)
  09156 Nervous system
   04725 Cholinergic synapse
    500131 (Creb5)
   04728 Dopaminergic synapse
    500131 (Creb5)
  09149 Aging
   04211 Longevity regulating pathway
    500131 (Creb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    500131 (Creb5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    500131 (Creb5)
  09162 Cancer: specific types
   05215 Prostate cancer
    500131 (Creb5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    500131 (Creb5)
   05161 Hepatitis B
    500131 (Creb5)
   05163 Human cytomegalovirus infection
    500131 (Creb5)
   05165 Human papillomavirus infection
    500131 (Creb5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    500131 (Creb5)
   05020 Prion disease
    500131 (Creb5)
  09165 Substance dependence
   05030 Cocaine addiction
    500131 (Creb5)
   05031 Amphetamine addiction
    500131 (Creb5)
   05034 Alcoholism
    500131 (Creb5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    500131 (Creb5)
   04934 Cushing syndrome
    500131 (Creb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500131 (Creb5)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    500131 (Creb5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DUF6262 DivIC
Other DBs
NCBI-GeneID: 500131
NCBI-ProteinID: NP_001128093
RGD: 1566107
Ensembl: ENSRNOG00000008622
UniProt: D3ZBH0
Position
4
AA seq 561 aa
MMQRNPGRKFANFHHFGQDAWSPRGGRASLQGALSPTGAQRPLPSLETRYRLQLIYEESK
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSFEHEFRKAQEEESSKRNISMHNTVGGTMTGPGAHQLGSSRMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMSTIGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSE
VVGSSTLSQLTSHRTDLNPIL
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgatgcagcggaaccccgggagaaagtttgcaaacttccaccatttcggccaagacgcc
tggtcacctaggggcggccgggcgagtttgcagggggctctctctcccaccggtgcccag
cggccgctgccatctctcgagacccgctaccggctgcagctgatttatgaggaatccaag
atgaacttggagcaggagaggccgtttgtctgcagtgccccaggctgctctcagcgtttc
ccaacagaggaccatctgatgattcataggcacaagcatgagatgactttgaagtttcct
tcgataaaaacagacaacatgctatcagatcagactccaacgccaacaagattcctgaag
aactgtgaggaggtgggtctcttcagcgagctggactgctcctttgagcacgagttcagg
aaggctcaagaggaagagagcagcaagaggaatatctccatgcacaatacagttggtggg
accatgacggggcctggagctcaccagttaggcagctcacggatgcccaaccacgacacc
agtgttgtgattcagcaagccatgccttcaccccagtccagctcagtcatcacgcaggct
ccctccaccaaccgccagatcgggcctgtcccaggctctctatcatctctgctccatctc
cacaacagacagagacagcccatgccagcctccatgcctggaaccctgcccaaccccacc
atgccgggatcttctgccgtcttgatgcctatggaaaggcagatgtcagtgaactccagc
atcatgggcatgcaaggtccaaaccttagcaacccctgtgcttctccccaggttcagccc
atgcattctgaagccaaaatgagattgaaggctgcattgactcaccatcctgctgccatg
tcgaatgggaacatgagcaccatcggacacatgatggagatgatgggctcccggcaagac
cagacgccgcaccaccacatgcattcgcacccgcatcagcaccagacactgccgccccac
cacccctatccacaccagcaccagcaccccgcacaccatccccacccacaacctcaccac
cagcagaaccacccgcaccaccactcccattcccacctccacgcacacccggcgcaccac
cagacctcgccacacccgcccctgcacaccggcaaccaagcacaggtttcaccagccaca
caacagatgcagccaacccagacaatacaaccgccccagcccacagggggacgccgacga
agggtggtggatgaggacccagatgagaggcggaggaaatttctggaaaggaaccgggcc
gccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagct
gaagagctcacccagacaaacatgcagcttcagaatgaagtgtccatgttgaaaaatgag
gtggcccagctgaagcagttgttgttaacacataaagactgtccaataacagccatgcag
aaagaatcacaaggatacttaagtccagagagcagccctcctgcgagccccgtgccagcg
tgctctcagcagcaagtcatccagcataacaccatcacgacatcctcatcggtcagcgag
gtggtggggagctccaccctcagtcagctcacgagtcacagaacagacctgaaccctatt
ctctaa

KEGG   Rattus norvegicus (rat): 79255
Entry
79255             CDS       T01003                                 

Gene name
Atf4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04137  Mitophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04932  Non-alcoholic fatty liver disease
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    79255 (Atf4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    79255 (Atf4)
   04668 TNF signaling pathway
    79255 (Atf4)
   04022 cGMP-PKG signaling pathway
    79255 (Atf4)
   04151 PI3K-Akt signaling pathway
    79255 (Atf4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    79255 (Atf4)
  09143 Cell growth and death
   04210 Apoptosis
    79255 (Atf4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    79255 (Atf4)
   04922 Glucagon signaling pathway
    79255 (Atf4)
   04912 GnRH signaling pathway
    79255 (Atf4)
   04915 Estrogen signaling pathway
    79255 (Atf4)
   04926 Relaxin signaling pathway
    79255 (Atf4)
   04935 Growth hormone synthesis, secretion and action
    79255 (Atf4)
   04918 Thyroid hormone synthesis
    79255 (Atf4)
   04928 Parathyroid hormone synthesis, secretion and action
    79255 (Atf4)
   04925 Aldosterone synthesis and secretion
    79255 (Atf4)
   04927 Cortisol synthesis and secretion
    79255 (Atf4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    79255 (Atf4)
  09156 Nervous system
   04725 Cholinergic synapse
    79255 (Atf4)
   04728 Dopaminergic synapse
    79255 (Atf4)
   04720 Long-term potentiation
    79255 (Atf4)
   04722 Neurotrophin signaling pathway
    79255 (Atf4)
  09149 Aging
   04211 Longevity regulating pathway
    79255 (Atf4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    79255 (Atf4)
  09162 Cancer: specific types
   05215 Prostate cancer
    79255 (Atf4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    79255 (Atf4)
   05161 Hepatitis B
    79255 (Atf4)
   05163 Human cytomegalovirus infection
    79255 (Atf4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    79255 (Atf4)
   05012 Parkinson disease
    79255 (Atf4)
   05014 Amyotrophic lateral sclerosis
    79255 (Atf4)
   05020 Prion disease
    79255 (Atf4)
   05022 Pathways of neurodegeneration - multiple diseases
    79255 (Atf4)
  09165 Substance dependence
   05030 Cocaine addiction
    79255 (Atf4)
   05031 Amphetamine addiction
    79255 (Atf4)
   05034 Alcoholism
    79255 (Atf4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    79255 (Atf4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    79255 (Atf4)
   04934 Cushing syndrome
    79255 (Atf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79255 (Atf4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    79255 (Atf4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 Fez1 Laminin_II DUF3450 AAA_13
Other DBs
NCBI-GeneID: 79255
NCBI-ProteinID: NP_077379
RGD: 621863
Ensembl: ENSRNOG00000017801
Vega: OTTRNOG00000002100
UniProt: Q9ES19 B0BMW3
Position
7
AA seq 347 aa
MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWL
AMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDL
FAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLEL
GSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAP
PDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQE
ALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaagtgttggcgggggacttaatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactatctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggcgggctcctcagaatggctg
gctatggatgggttggtcagtgcctcagacaccggcaaggaggatgccttttccgggaca
gattggatgttggagaaaatggacctgaaagagtttgacttcgatgctctgtttcgaatg
gatgacctggaaaccatgccagatgagcttttggccacgttggatgacacatgtgatctt
tttgcccctctagtccaagagactaataaggagccccctcagacagtgaacccaattggc
catctcccagaaagtgtaataaaagtcgaccaggctgccccctttacattcttgcagcct
cttccctgttccccagggtttctgtcttccactccagatcattcctttagtttagagctg
ggaagtgaggttgatatctctgaaggagataggaagcctgactctgctgcttatattact
ctaacccctcagtgtgtaaaggaggaagacactccctctgatagtgacagtggcatctgt
atgagccctgagtcctacctgggctctccccaacacagcccttccacctccagggcccca
ccagacagtctgccttctccaggtgttcctcgtggttctcgacccaaaccttatgaccca
cctggagttagtgtgacagctaaagtgaagactgaaaagttggataagaagctgaaaaag
atggagcaaaacaagacagcagctactaggtaccgccagaagaagagggctgagcaggaa
gccctcactggcgagtgtaaagagctagaaaagaagaacgaggctctgaaagagaaggca
gattctctcgccaaagagattcagtatctaaaagacctgatagaagaggtccgtaaggca
agggggaagaagagagttccttaa

KEGG   Rattus norvegicus (rat): 81646
Entry
81646             CDS       T01003                                 

Gene name
Creb1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform A
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04380  Osteoclast differentiation
rno04612  Antigen processing and presentation
rno04668  TNF signaling pathway
rno04710  Circadian rhythm
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    81646 (Creb1)
   04024 cAMP signaling pathway
    81646 (Creb1)
   04022 cGMP-PKG signaling pathway
    81646 (Creb1)
   04151 PI3K-Akt signaling pathway
    81646 (Creb1)
   04152 AMPK signaling pathway
    81646 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    81646 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    81646 (Creb1)
   04922 Glucagon signaling pathway
    81646 (Creb1)
   04915 Estrogen signaling pathway
    81646 (Creb1)
   04926 Relaxin signaling pathway
    81646 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    81646 (Creb1)
   04918 Thyroid hormone synthesis
    81646 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    81646 (Creb1)
   04916 Melanogenesis
    81646 (Creb1)
   04924 Renin secretion
    81646 (Creb1)
   04925 Aldosterone synthesis and secretion
    81646 (Creb1)
   04927 Cortisol synthesis and secretion
    81646 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81646 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    81646 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    81646 (Creb1)
   04728 Dopaminergic synapse
    81646 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    81646 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    81646 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    81646 (Creb1)
   04713 Circadian entrainment
    81646 (Creb1)
   04714 Thermogenesis
    81646 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81646 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    81646 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    81646 (Creb1)
   05161 Hepatitis B
    81646 (Creb1)
   05163 Human cytomegalovirus infection
    81646 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    81646 (Creb1)
   05165 Human papillomavirus infection
    81646 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    81646 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    81646 (Creb1)
   05020 Prion disease
    81646 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    81646 (Creb1)
   05031 Amphetamine addiction
    81646 (Creb1)
   05034 Alcoholism
    81646 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    81646 (Creb1)
   04934 Cushing syndrome
    81646 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81646 (Creb1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    81646 (Creb1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    81646 (Creb1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    81646 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 81646
NCBI-ProteinID: NP_604392
RGD: 620218
Ensembl: ENSRNOG00000013412
UniProt: P15337
Structure
PDB: 
1KDX

Position
9
AA seq 327 aa
MTMDSGADNQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggactctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaagtcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcgacgtcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggggtcatccaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtct
gtggatagtgtaactgattcccaaaaacgaagggaaatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aaatcagaagaagagacttcagcccctgccatcaccactgtaacagtgccaaccccgatt
taccaaactagcagtgggcagtatattgccattacccagggaggagcaatacagctggct
aacaatggtaccgatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacaatatgcacagaccactgatggacagcagattcta
gtgcccagcaaccaagttgttgttcaagctgcctctggtgatgtacaaacataccagatt
cgcacagcacccactagcaccattgcccctggagttgttatggcgtcctccccagcactt
cctacacagcctgctgaagaagcagcacgaaagagagaggttcgtctaatgaagaacagg
gaagcagcaagagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagagaacaga
gtggcagtgcttgaaaaccaaaacaaaacattgattgaggagctaaaagcacttaaggac
ctttactgccacaagtcagattaa

KEGG   Rattus norvegicus (rat): 81647
Entry
81647             CDS       T01003                                 

Gene name
Atf2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81647 (Atf2)
   04668 TNF signaling pathway
    81647 (Atf2)
   04022 cGMP-PKG signaling pathway
    81647 (Atf2)
   04151 PI3K-Akt signaling pathway
    81647 (Atf2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    81647 (Atf2)
   04922 Glucagon signaling pathway
    81647 (Atf2)
   04915 Estrogen signaling pathway
    81647 (Atf2)
   04926 Relaxin signaling pathway
    81647 (Atf2)
   04935 Growth hormone synthesis, secretion and action
    81647 (Atf2)
   04918 Thyroid hormone synthesis
    81647 (Atf2)
   04928 Parathyroid hormone synthesis, secretion and action
    81647 (Atf2)
   04925 Aldosterone synthesis and secretion
    81647 (Atf2)
   04927 Cortisol synthesis and secretion
    81647 (Atf2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81647 (Atf2)
  09156 Nervous system
   04728 Dopaminergic synapse
    81647 (Atf2)
  09149 Aging
   04211 Longevity regulating pathway
    81647 (Atf2)
  09159 Environmental adaptation
   04714 Thermogenesis
    81647 (Atf2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81647 (Atf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    81647 (Atf2)
   05161 Hepatitis B
    81647 (Atf2)
   05163 Human cytomegalovirus infection
    81647 (Atf2)
  09164 Neurodegenerative disease
   05020 Prion disease
    81647 (Atf2)
  09165 Substance dependence
   05030 Cocaine addiction
    81647 (Atf2)
   05031 Amphetamine addiction
    81647 (Atf2)
   05034 Alcoholism
    81647 (Atf2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81647 (Atf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81647 (Atf2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    81647 (Atf2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Other DBs
NCBI-GeneID: 81647
NCBI-ProteinID: NP_112280
RGD: 621862
Ensembl: ENSRNOG00000001597
UniProt: Q00969
Position
3
AA seq 487 aa
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL
PHPESTTNDEKEIPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV
PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRAQSEESRPQSLQQP
ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKTEAGATSVLTQMADQSTEPALSQIVMAPSS
QAQPSGS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttctatgcactgcccctgggtgtggccagcgttttaccaac
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccagca
cgtaatgacagtgtcattgtggctgatcagactccaacgccaacaaggttcctaaaaaac
tgtgaagaagtgggtttgtttaatgagttggcaagtccattcgagaatgaattcaagaag
gcttcagaagatgacattaaaaaaatgcctctagatctgtcccctcttgcaacacccatc
ataagaagcaaaattgaggaaccttctgttgtagaaacaactcaccaggatagcccgtta
cctcaccccgagtctactaccaatgatgaaaaggaaataccattggcacaaactgcacag
cccacatcagctatcgttcgtccagcatcattacaggttcccaatgtgctgctcacaagt
tctgactcaagtgtaattattcaacaagcagtaccttcaccaacctcaagtactgtaatc
acccaggcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttcta
ttacatcttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttct
aatgtgcatgttccagctgcagtcccacttgttcggccagtcaccatggtgcctagtgtt
ccaggaatcccaggcccttcctctcctcaaccggtccagtcagaagcaaaaatgagatta
aaagctgctttgacccagcaacaccctccagttaccaatggtgatactgtaaaaggccac
ggcagtggattggttagggcccagtcagaagagtctcgtccacagtccttgcagcagcca
gccacgtccactacagagactccggcgtctccagctcacacaactccacagacccaaaat
acaagtggccgtcgaagaagagcagctaatgaagatcctgatgagaaaaggaggaagttt
ctagaacgaaatagagcagcagcttcaagatgccgtcaaaaaaggaaagtatgggttcag
tccttagagaagaaagcagaagacttgagctcactaaatggccagctgcagagcgaagtc
accctgctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgc
cctgtaaccgccatgcagaagaagtctggctatcatactgctgataaagatgacagctca
gaagacctttccgtgccaagcagcccacatacagaagcgatccagcacagctctgtcagt
acgtccaatggagtcagttcaacatcaaaaacagaagctggagccacttcagtcctcacc
cagatggcggaccagagcaccgagcctgcactttcacagattgtcatggctccttcctcc
caggcacagccctcaggaagttga

DBGET integrated database retrieval system