KEGG   Rattus norvegicus (rat): 310621Help
Entry
310621            CDS       T01003                                 

Gene name
Iqgap3
Definition
(RefSeq) IQ motif containing GTPase activating protein 3
  KO
K05767  Ras GTPase-activating-like protein IQGAP2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    310621 (Iqgap3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    310621 (Iqgap3)
   04147 Exosome [BR:rno04147]
    310621 (Iqgap3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     310621 (Iqgap3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   310621 (Iqgap3)
  Exosomal proteins of colorectal cancer cells
   310621 (Iqgap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGAP RasGAP_C CH IQ SHD1 CAMSAP_CH WW S-antigen
Motif
Other DBs
NCBI-GeneID: 310621
NCBI-ProteinID: NP_001178638
RGD: 1305951
Ensembl: ENSRNOG00000027894
UniProt: D3ZCS4
Position
2q34
AA seq 1632 aa AA seqDB search
MESCTAGQARTAYDRLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEVCLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDMEQLRYQATGLHFRHTDNINFWLSAVAHIGLPS
TFLPETTDIYDKKNMPRVIYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNIASELA
KYGLQLPAFSKIGGILANEFSADEAAVHAAILAINDAVERGVVEDTLVALQNPNALLGNL
REPLAAVYQELLALAKMEKAANARNHDDGQDQDIYESCLTQAEIQGHINLANVQGALEVV
DDALERQSPEALLEALRDPVLALQGVRQAFADWYLEQLTSDREQKSQELGLVRLLEKEEI
QAGVAAANEKGDQEQAMLRAVWKINKAIQRGVAADTVKELMCPEAQLPQVYPFASAVYQQ
ELALLQKQQQGELDQEELFVAVEMLSAVVLINRALEAGDACTFWDNLVNPATGLAQVEEE
NAQRYFDALVKVQQLRGTHRGFLSWNDLQAAVSQVNAQVQEETDQVLAISLINEALDQGC
PEKTLSALLLPAAGLEDVSLPVAPRYHHLLVAAKRQKAQKTGDPGAVLWLEEIRQGVARA
NEDTNTAQRIALGVAAINQAIKEGKAAQTERVLRNPNVALRGIVPDCAKSYQQALEGAAA
KKHRPGDTAFWVPRDMKDGTAYYFHLQTFQGTWERPPSRHLNASHLTWEEIQSVITKVTA
AHDRQLLWKANVGFVIKLQARLRGFLVRQKFAESSHFLRTLLPAVIKIQAHWRGYRQRKT
YQERLQYFKANLNAIITIQAWARMWAARRQYLRRLRYFQKNVDSVVKIQAFFRARKARDD
YRMLVHARHPPLSVVRKFAHLLNQSQEDFSAEAELLRLQEEVVRKIRSNQQLEQDLNLMD
IKIGLLVKNRITLQEVVSHCKKLTKKNKEQLSDMMILDKQKGLKSLSREKRQKLEAYQHL
FYLLQTQPIYLAKLIFQMPQNKTTKFMEGVIFSLYNYASNRREAYLLLQLFRTALQEEIK
SKVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDRSVSIHTDPVHIY
KSWINQVEAQTGQRSHLPYDVTPEQALSHSEVQRRLDISLRNLLAMTEKFFVAISSSVDH
IPYGIRYMAKVLKTTLETKFPNATERDIYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGS
SLAAPQRHALGAVAQLLQHAAAGKVFSGESRHLRILNGYLEDLHHKFRKFICRACRVPEP
EERFAIDEYSDMVAVAKPMVYITVGELIGTHRLLLEHQDQLAPGHQDPLHQLLEDLGEPP
TITDLIGDHVATDGHEDLSRLEVSLTLTNKFEGLETDADHNSTQSLLLSTKQMLADLIQF
HPGDSLEEILTSSAPREHEEAHHRLMCWRQACDTQKPEPLQRRHSLMAHSLLPLAEKQQR
VLRNLRRLQGLGLVRANDCYQGLVDELAKDICNQRRHRQRRKAEMLRLRATLQGLDAKTI
FYEEQGDYYNQYTQACLDHLAPNPRSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPVSHF
RNVIFDITPGDEAGRFAVNAKFLGVDMEKFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNL
LIFLLNKKFLRK
NT seq 4899 nt NT seq  +upstreamnt  +downstreamnt
atggagtcttgcacggcaggccaggctcggacagcctatgatcgtctcacagctgaggag
atggatgagcagaggcgacagaatgtcgcctaccagtacctgtgccggctggaggaagcc
aagcgctggatggaggtgtgcttgaaggaggagcttccttcccctgtggagctggaggag
agcctccggaatggagtgcttctggccaagctgggccactgttttgcaccctctgtggtc
cccctgaagaagatctatgacatggaacagctacgataccaggcgaccggcttgcatttc
cggcacacggacaacatcaacttctggctttctgcggtagcccacatcggtctgccttcg
accttcctcccagagaccacagacatctatgacaaaaagaacatgcctcgggtgatctac
tgcattcatgctctcagtctcttcctcttccggctgggattggcccctcagatccacgac
ttgtatggaaaagtgaaattcacagctgaggaactcagcaacatcgcctctgaactggcc
aaatatggcctccagttaccggccttcagcaaaatcgggggcatcctggccaatgagttt
tcagccgatgaggctgcagtccatgcagctattctggccatcaatgacgcagtggagcga
ggggtggtggaagacactctggtggccttgcagaatcccaatgctcttctggggaatctt
cgggaacctttggcagctgtctaccaagagctgttggccctagccaagatggagaaggct
gccaatgccaggaatcatgacgatggtcaggaccaggacatctatgagtcctgcctcacc
caggcagagatccagggccacatcaacctcgccaatgtccagggggctctggaagttgtt
gatgacgctctggagaggcagagccctgaggccttgcttgaggcccttcgtgaccctgtc
ctggccctacaaggggtgagacaagcctttgctgactggtacctggaacagctgacttca
gacagggagcagaaatcacaggagctgggcctggtgaggcttctagaaaaggaggagatc
caggctggtgtggctgcagccaatgagaagggtgatcaagagcaggctatgctccgagct
gtgtggaagatcaacaaagccatccagaggggagtggccgctgacaccgtgaaggagctc
atgtgccctgaagcccagctgccccaagtatacccctttgcctctgctgtgtaccagcag
gagctggctctcctccagaagcagcaacagggggaactggaccaggaggagctctttgtg
gctgtggagatgctctcagccgtggttctgattaaccgtgctctggaagctggagatgcc
tgtaccttttgggacaatctggtgaaccccgcaactggcctggcccaggttgaagaagaa
aatgcccaacgttactttgatgccctggtgaaggtgcagcagcttcgaggaacgcataga
ggcttcctgagctggaatgacctgcaggcggctgtgagtcaagtcaatgcacaggtccag
gaagaaactgatcaggttctcgccatcagcctcatcaatgaggctctggaccagggctgt
cctgaaaagactctgtctgccctgctgcttcctgcagctggcctggaagatgtcagcctt
cctgttgcaccccggtaccatcaccttcttgtggctgccaagaggcagaaagcacagaaa
acgggagatcctggagctgtgctatggctggaggagatccgccagggagtggccagagcc
aacgaggacacaaacacagctcaaagaatagcccttggtgtggctgctatcaaccaggcc
atcaaggagggcaaggcagcccagacagagcgtgtgttgaggaaccccaatgtggccctc
cgagggatagttcctgactgcgctaaaagctaccaacaggccctggaaggcgcagcggca
aagaagcaccgtcctggggacacagccttctgggttccacgtgacatgaaggatggcacc
gcctactacttccatctgcagacctttcaggggacctgggagcgtcctcccagccgccac
ctcaatgcctcccatctcacctgggaggagattcagtctgtcatcaccaaggtcaccgct
gcccacgaccgccagctgctctggaaggccaacgttggctttgtcatcaagctccaggct
cgccttcgtggcttcctcgttcgccagaagtttgctgagtcttcccacttcctcaggacc
ttgctgccagccgtcatcaagatccaggcccactggcggggttatagacaacggaagact
taccaggagcggctgcagtattttaaagcaaacctgaatgctattatcacgatccaggcc
tgggcccgaatgtgggcagcacgaaggcagtacctcaggcgtctgcgatacttccagaag
aacgttgactccgttgtgaagattcaagcatttttccgagccaggaaggcccgtgatgac
tacaggatgttagtgcacgcacgccaccctcccctctctgtggtccggaaattcgctcac
ctcttgaaccagagtcaggaggacttctcggctgaggcggagctgctgaggctgcaggaa
gaagtggtcaggaagatccgctctaatcagcagctggagcaggacctcaacctcatggac
atcaagattggcctgctggtcaagaaccggatcaccctgcaggaggtagtctcccactgc
aagaagctgaccaagaagaataaggagcaactgtcagacatgatgatcctggacaaacag
aagggattaaagtcactgagcagagagaaacggcagaagctagaagcctaccagcacctc
ttctacctgctgcagactcagcccatctatttggccaaactgatctttcaaatgccccag
aacaaaaccaccaagttcatggaaggcgtgattttcagtctgtacaactatgcctccaac
cgccgggaggcctaccttctgctccagctgttcagaacggcactgcaggaggaaatcaag
tcaaaggtggaacagccccaggatgtggtgacaggcaacccaacagtagtgagactggtg
gtgaggttctaccgcaatgggcggggacagagcgctctgcaggagatccttggcaaggtc
atccaggatgtgctcgaagacaggtcagtcagcatccacacagatcctgtccacatctat
aagagctggatcaaccaggtggaggcccagactggacagcgcagccatctcccctatgac
gtcacccccgagcaggctctgagccactctgaagtgcagagacgattagacatctccctg
cgcaatctcctcgccatgactgaaaagttcttcgttgccatcagttcatcggtggaccac
attccgtatgggattcggtatatggccaaagtcctgaaaacaaccctagagacaaagttc
cccaatgccacggagagggacatctataaggtggttggaaacctcctgtactaccgcttc
ctgaaccctgctgtggtagctcctgacgcctttgacattgtggccatggcagcaggcagc
agcctggccgccccacagcgccatgcgctaggagctgtggctcagctcctacagcatgcg
gctgctggcaaggtcttctccggggagagccggcaccttcgaatcctgaatggctacctg
gaggacttgcatcacaagttcaggaagttcatctgcagagcatgccgggtaccagagccc
gaggagcgcttcgccatagatgaatactcagacatggtggctgtggccaaacccatggtg
tacatcaccgtaggggagttgatcggcacacacaggctcttgctggaacaccaagaccag
ctggccccaggtcaccaggacccactgcaccagctcctggaggaccttggggagccaccc
accatcactgacctcatcggggaccatgtagccaccgatgggcatgaggatctgagcagg
ctcgaagtgtccctgacactcaccaacaagttcgaagggctggagacagatgctgaccac
aacagcacccaaagtctgcttctgagcaccaaacagatgctggccgacctcatccagttc
caccctggggactccctggaggagatcctgacctcctcagctcccagggagcatgaagag
gcccatcatcggttgatgtgttggcgccaagcctgtgacacccagaaaccagagccgctt
caacgacgacactcactgatggcacactccctcctgccactggcagagaagcagcaacgc
gtcctgcggaacctgcgtcggctacagggcctggggctggtcagggccaacgactgctac
cagggacttgtggacgagctggccaaggacatctgcaaccagcgcaggcaccgacagcgg
cggaaggcagagatgctgaggctccgggccacgctacagggcctagatgcaaaaaccatc
ttctatgaggaacagggcgactactacaaccagtacacccaggcctgccttgaccacctg
gcccccaaccccaggagttctgggaaggggaagaagcagccgtctcttcactacacagcc
gcccagctcctggaaaagggtgtcttggtggaaattgaagatctccctgtctctcacttc
agaaacgtcatctttgacatcactcctggagatgaggcaggaaggttcgccgtcaatgcc
aagttcctgggtgtagacatggagaagtttcagctccactaccaggacctcttgcagctg
cagtatgagggtgtggctgtcatgaaactctttaacaaagccaaagtcaacgtcaatctc
ctcatcttcctgctcaacaagaagttccttcggaagtga

DBGET integrated database retrieval system