KEGG   Rattus norvegicus (rat): 310630Help
Entry
310630            CDS       T01003                                 

Gene name
Sema4a
Definition
(RefSeq) semaphorin 4A
  KO
K06521  semaphorin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    310630 (Sema4a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    310630 (Sema4a)
CD molecules [BR:rno04090]
 Proteins
  310630 (Sema4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema PSI PSI_integrin
Motif
Other DBs
NCBI-GeneID: 310630
NCBI-ProteinID: NP_001012078
RGD: 1304636
Ensembl: ENSRNOG00000019737
Vega: OTTRNOG00000002425
UniProt: F7F3I7
Position
2q34
AA seq 762 aa AA seqDB search
MTMALPSLGQDPWSLLSVFFFQLFLLLSLPPASGTGGQGPVPRVKYHAGDGHRALSFFQQ
KGLRDFDTLLLSGDGNTLYVGAREAILALNIENPGIPRLRNMIPWPASEKKKNECAFKKK
SNETQCFNFIRVLVSYNATHLYACGTFAFSPACTFIELQDSFLLPILKDKVTDGKGQSPF
DPAHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDIFLRWLHPDASFVAAIP
STQVVYFFFEETASEFDFFEELYTSRVAQVCKNDVGGEKLLQKKWTTFLKAQLLCAQPGQ
LPFNIIRHAVLLPADSPSVPRIYAVFTSQWQVGGTRSSAVCAFSLTDIERVFKGKYKELN
KETSRWTTYRGSEVNPRPGSCSMGPSSDKALTFMKDHFLMDEHVVGAPLLVKSGVEYTQL
AVETAQGLDGSSHVVLYLGTSTGSLHKAVVPQNSSAYLVEEIQLSPNSEPVQNLQLAPTQ
GAVFAGFSEGIWRVPRANCSVYKSCVDCVLARDPHCAWDPESRLCSLLSGSPLTWKQDME
RGNPEWACARGPMARSPRRQSSPQLIKEVLTVPNSILELPCPQLSALASYHWSHGKAKIP
EASSTVYNGSLLLLPQDGVGGLYQCVATENGYSYPVVSYWVDSQDQPLALDPELAGVPRE
RVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVLLGVLTLLLASPLGVLRARGKVQGC
GMLPPREKAPLSREQHLQPSKDHRTSASDVDADNNHLGAEVA
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggccctaccatccctgggccaagacccctggagtctcctgagtgtttttttc
ttccaactgttcctgctgctgtcactgccaccagcttccgggactggtgggcagggaccc
gtgcccagagtcaagtaccatgcgggagatgggcacagggccctcagcttctttcaacaa
aaaggcctccgggactttgacaccctgctcctgagtggagatggcaacactctgtatgtg
ggggctcgggaggccatcttggccctgaatatcgagaatccaggaatcccaaggctgagg
aacatgataccctggccagccagtgagaaaaaaaagaacgaatgtgcctttaagaagaaa
agcaatgagacacagtgtttcaacttcattcgtgtgctggtctcttacaatgccactcac
ctctatgcctgcgggacttttgccttcagccccgcctgcaccttcattgaactccaagat
tccttcctgttgcccatcttgaaggacaaggtcacagatgggaagggtcaaagccccttt
gaccctgctcacaagcacacagctgtcttggtcgatgggatgctttattctggcaccatg
aacaacttcctgggcagcgaacccatcctgatgcggacactgggatcccagcctgttctc
aagactgacatcttcctacgctggctgcacccggacgcctccttcgtggcagccatccca
tctacccaggtcgtctatttcttctttgaggagacagccagcgagtttgacttctttgag
gagctgtacacatccagggtggctcaagtctgcaagaacgacgtaggcggtgaaaagctg
ctgcagaagaagtggaccaccttcctgaaagcccagctgctctgcgctcagccagggcag
ctgccattcaacatcatccgccacgcggtcctgctgcccgccgattctccctctgttccc
cgcatctacgcagtctttacctcccagtggcaggttggtgggaccaggagctcagcagtc
tgtgccttctctctcacggacattgagcgagtctttaaaggaaagtacaaggagctgaac
aaagaaacctcccgctggaccacttacaggggctcagaggtcaacccgaggccaggcagc
tgctccatgggcccctcctctgacaaagccttgaccttcatgaaggaccattttctgatg
gatgagcatgtggtaggagctcccctgctggtgaagtctggcgtggagtacacacagctt
gccgtggaaacagctcagggccttgacgggagcagccatgtggtcctttacctgggtacc
tctacggggtccctgcacaaagctgtggtgcctcagaatagcagtgcttatcttgtggag
gagattcagctgagccctaactctgagcctgttcagaacctgcagctggcccccacccag
ggtgcagtgttcgcaggcttctctgaaggcatctggagggttcccagggccaactgcagt
gtctataagagctgtgtggactgtgtccttgccagggaccctcactgtgcctgggaccct
gaatcaagactgtgcagccttctgtctggctctcccctgacttggaagcaggacatggaa
cgcggcaacccggagtgggcatgcgcccgtggccccatggccaggagcccccggcgtcag
agctcccctcaactcattaaagaagtcctgacagtccccaactccatcctggagctgccc
tgcccccagctgtcagcactggcctcttaccactggagtcacggcaaagccaaaatccca
gaagcctcttctactgtctataatggctccctcttgttgctgccacaggatggcgttggg
ggcctctaccagtgcgtggccactgaaaacggctattcgtaccctgtagtctcctactgg
gtagacagccaggaccagcccctggcactggatcctgagctggcgggcgttccccgggag
cgagtgcaggtcccactgaccagggtcggaggcggggcttctatggctgcccagcggtcc
tactggccccattttctcatcgttactgtcctcctggccattgtgctcttgggagtgctc
actctcctccttgcttccccactgggagtgcttcgggctcggggtaaggttcagggctgt
gggatgctgccccccagggaaaaggccccactgagcagggaacagcacctccagccttcc
aaggaccacaggacctctgccagcgacgtagatgctgacaacaaccatctgggcgctgaa
gtggcttaa

DBGET integrated database retrieval system