KEGG   Rattus norvegicus (rat): 310641Help
Entry
310641            CDS       T01003                                 

Gene name
Trim46
Definition
(RefSeq) tripartite motif-containing 46
  KO
K12022  tripartite motif-containing protein 46
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    310641 (Trim46)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    310641 (Trim46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-B_box zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-C3HC4_4 zf-RING_5 fn3 zf-RING_2 CEBP_ZZ Prok-RING_4 Tissue_fac COS DLP_helical
Motif
Other DBs
NCBI-GeneID: 310641
NCBI-ProteinID: NP_001101161
RGD: 1305993
Ensembl: ENSRNOG00000055433
UniProt: A0A0G2JXN2
Position
2q34
AA seq 561 aa AA seqDB search
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQTILFPCPACQGDVELGERGLSGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCSECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLAYILGNQDTVQTQICELEETIR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRSSLLQAIEECQQERLSRLSAQIHEHQSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPGEYTERWLHVV
NGDEQPVPQTYLSSGFPLTQI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggctgagggtgaggatatgcagaccttcacttccatcatggatgcactagtccgcatc
agtacaagcatgaagaacatggagaaggaactgctgtgcccagtgtgccaagagatgtac
aagcagccactagtgctgccttgtacccacaacgtgtgccaggcctgtgcccgggaggtt
ttgggccagcaggggtacataggccatggtggggatccgagttcggagcccacttctcct
gcttccaccccttctacccgcagcccccgcctctctcggagaactctccccaagccagat
cgcttggaccggctccttaagtcaggctttgggacataccctgggcggaagcgtggtgcc
ttgcacccccagacgatcttattcccgtgcccagcctgccagggcgatgtggaactgggg
gagaggggcctttccgggcttttccgaaacctgaccctagagcgagtggtggagcggtac
cgacagagtgtgagtgtgggcggcgccatcctgtgccagttgtgcaagcccccaccacta
gaggccaccaagggctgctcagagtgtcgagctaccttctgtaatgaatgcttcaagctc
ttccacccctggggcactcagaaggcccaacacgaacccacgctacccaccctctcattc
cgccccaagggtctgatgtgtccagaccacaaggaagaggtgacccactactgtaagaca
tgtcaacgactggtgtgccaactctgcagggtacggcgtacccacagtgggcacaagatc
acaccagtgctcagtgcctaccaggctctcaaggataagctaactaagagcctggcatac
atcttgggaaaccaggacacagtgcagacccagatttgtgagctggaggagaccatcagg
cacactgaggtgagtggtcagcaggcgaaagaggaggtgtcccagctggttcggggacta
ggggctgtgttggaagagaagcgatcctcacttcttcaggccatcgaagagtgccagcaa
gagcgtttatcccggctcagtgcccagatccatgagcaccagagcctgctggatggctcg
ggtttggtgggctacgcccaggaagttcttaaggaaacagaccagccttgctttgtacaa
gcagccaaacagctgcataacaggattgcccgagccaccgaggccctccagacattccgg
ccagctgccagctcctccttccgtcattgccagctggatgtgggacgggagatgaagttg
ctgacagagcttaacttcctgagagtgcccgaggcgcctgtcatcgacacccaacgcacc
tttgcctatgaccaaatcttcctgtgctggcggctgccccctcactcaccacctgcctgg
cattacactgtggagttccggcgcacagatgtccccgcccagccaggccctacacgctgg
cagcgacgggaggaggtgaggggcaccagtgccctcctggagaaccctgacacgggctct
gtgtatgtgctgcgtgtccgtggctgcaacaaagctggctacggagagtacagtgaagat
gtgcacctgcacacacccccagcacctggtgagtacacagaaaggtggcttcatgtggtg
aacggagatgaacagcctgtacctcagacgtatctttcctctggattcccactcacgcag
atatga

DBGET integrated database retrieval system