KEGG   Rattus norvegicus (rat): 310643Help
Entry
310643            CDS       T01003                                 

Gene name
Efna4
Definition
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    310643 (Efna4)
   04015 Rap1 signaling pathway
    310643 (Efna4)
   04010 MAPK signaling pathway
    310643 (Efna4)
   04151 PI3K-Akt signaling pathway
    310643 (Efna4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    310643 (Efna4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    310643 (Efna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    310643 (Efna4)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    310643 (Efna4)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   310643 (Efna4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   310643 (Efna4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 310643
NCBI-ProteinID: NP_001101162
RGD: 1307808
Ensembl: ENSRNOG00000020588
UniProt: D3ZEN1
Position
2q34
AA seq 204 aa AA seqDB search
MRLLPLLRTVLWAALLGSRLRGCSSLRHSIYWNSTNPRLLRGDAVVELGLNDYLDIFCPH
YESPGPPEGPETFALYIVDWSGYEACKAEGANAFQRWNCTLPFAPFVPVRFSEKIQRFTP
FPLGFEFLPGETYYYISVPTPESPGQCLRLQVSVCCKEDRSESAHPVGSPGESGTSGWRG
GHAPSPLSLLLLLLLPILRLLRVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgttgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
cgggggtgctccagcctccgccactctatctactggaactccactaaccccaggttgctt
cgaggagatgccgtggtggagctgggcctcaacgattacctagacatcttctgcccacat
tatgagagcccagggcccccagagggcccggaaacgtttgcattatacatagtggactgg
tcaggctacgaggcctgcaaggcagagggggcaaatgccttccagcgctggaattgcacg
ctaccttttgcgccttttgtccctgttcgattctccgaaaagattcagcgcttcacaccg
ttcccgctgggcttcgagttcttgcctggagagacttactactacatctcggtgccaact
ccggagagtcctggccagtgcctgagactccaggtgtctgtctgctgcaaggaggacaga
tccgagtcagctcatcctgtcgggagccctggagaaagtggcacatctgggtggcgggga
ggacacgcccccagccctctgtctctcctgctgttgctgctgctcccaatactccgtctt
ctgcgagttctgtga

DBGET integrated database retrieval system