KEGG   Rattus norvegicus (rat): 310669
Entry
310669            CDS       T01003                                 

Gene name
Golph3l
Definition
(RefSeq) golgi phosphoprotein 3-like
  KO
K15620  golgi phosphoprotein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310669 (Golph3l)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    310669 (Golph3l)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    310669 (Golph3l)
 Protein recycling
   Rab11 associated proteins
    310669 (Golph3l)
 Endosome - Golgi transport
   Rab associated proteins
    310669 (Golph3l)
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    310669 (Golph3l)
SSDB
Motif
Pfam: GPP34
Other DBs
NCBI-GeneID: 310669
NCBI-ProteinID: NP_001007699
RGD: 1359281
Ensembl: ENSRNOG00000047620
UniProt: Q66H74
Position
2q34
AA seq 285 aa
MTTLTHRTRRTEVSKSCEKKIESEEDTNQERSPDNEDPGDSKDIRLTLMEEVLLLGLKDK
EGYTSFWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLD
ETLKHIKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNF
LLFDMTTHPVTNTTEKQRLMKKLQDSVLERWVNDPQRMDRRTLALLVLAHSSDVLENVFS
CLTDDKYDVAMNRTKDLVELDPEVEGTKHNATEMIWAVLAAFNKS
NT seq 858 nt   +upstreamnt  +downstreamnt
atgacaacattaactcaccggacccgtcgaactgaagtgagtaagagctgtgaaaagaaa
atagaaagtgaggaagacactaatcaagaaaggagtccagataatgaagaccctggagac
tctaaggatatccgcctcactcttatggaagaagtattgctcctgggtctaaaagataaa
gagggctacacatctttctggaatgattgtatatcatctgggcttcgaggaggcatcctg
atagagctggccatgcggggtcgaatctatctagaacctcccaccatgcgtaagaagcga
ctcctagacagaaaggtcctgctaaagtcagacagcccaacaggtgatgttttgctggat
gaaacgctcaaacacattaaagcaactgagccaacagaaactgtgcagacgtggatcgag
ctactcactggtgagacatggaaccccttcaaattacagtaccagctgagaaatgtacga
gaacgaattgccaagaacctggtagaaaagggtattctaaccacagagaagcagaatttt
ctgctgttcgacatgaccactcatccagtgactaatacaacagagaaacagcgactaatg
aaaaagcttcaagacagtgtgctggaacggtgggtaaatgaccctcagcggatggacagg
cgaacactggcgctcctggtgctggcccactcctccgatgtgctggagaacgtcttctct
tgtcttacagatgataagtatgatgtggcaatgaatcgaaccaaggacctagtagaactg
gaccctgaagtggaagggacaaagcacaatgccacagagatgatctgggctgtgctggca
gccttcaacaaatcctaa

DBGET integrated database retrieval system