KEGG   Rattus norvegicus (rat): 310674
Entry
310674            CDS       T01003                                 

Gene name
Plekho1
Definition
(RefSeq) pleckstrin homology domain-containing family O member 1
  KO
K24022  pleckstrin homology domain-containing family O
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    310674 (Plekho1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   310674 (Plekho1)
SSDB
Motif
Pfam: PH HEPN_AbiU2 PH_11 PH_9
Other DBs
NCBI-GeneID: 310674
NCBI-ProteinID: NP_001020290
RGD: 1311487
Ensembl: ENSRNOG00000021170
UniProt: Q5BJM5
Position
2
AA seq 408 aa
MKKSGSGKRGPPDGNHQSVAPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSEKEVK
DEKNSQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLARCRQPGTTAPNLIFLAVSPEEKE
SWINALSSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTS
DGMLTLDLIQEEDPSPEEPASCAESFRVDLDKSVAQLAGSRRRADSDRIRPSSHRASSLS
RPWERPDKGAPYTPQALKKLPSTEKSRCASLEEILSQRDTAPAHPLHLQAEESPAPVPSQ
PGQLSRIQDLVARKLEKTQELLAEVQGLGDGKWKAKDPPRSPPDSQSEQLLLETERLLGE
ASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTSQHSQYRKSLM
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagaagagcggctccggcaagcgggggcctccggatggaaaccatcagtctgtggct
cccgagaaggtcggctgggtccggaaattctgcgggaaagggattttcagggagatttgg
aaaaaccgctatgtggtgctgaaaggcgaccagctctacgtctccgagaaggaggtaaaa
gatgagaaaaatagtcaagaggtgtttgacctgagtgactatgagaagtgcgaagagctc
cggaaatccaagagtaggagcaagaaaaaccacagcaagttcacactggcccgatgcaga
cagccgggcaccacggcccccaacctcatcttcctggcagtaagtcctgaggaaaaggaa
tcatggatcaacgccctgagttctgccattactagagctaaaaaccgcatcctggatgag
gtcaccgttgaggaggacagctatcttgcccaccctacccgagacagagcaaaaatccaa
cactcccgccgtcctccaacccggggacacctcatggctgtggcttccacctctacctca
gatgggatgctaacattagacctaatccaagaagaagacccttcccctgaggagccagcc
tcttgtgctgagagctttcgggtcgatctggacaagtctgtggcccagctggctggcagt
cgacggagagcggactcagacaggatccgtccctcttcacaccgggcaagcagcctttct
cggccttgggaaagaccagacaagggagccccctacaccccacaagcactgaagaagtta
cccagtacagagaagagccgatgtgcctccctggaggagatcctatcccagagggacact
gccccagcccaccctctccaccttcaagctgaggaatccccagcccctgtcccctcccag
ccggggcagctgtcccggatccaggacttggtagcaaggaaactggagaagactcaggag
ctgctggcagaggttcagggactgggagatggcaaatggaaggccaaggaccccccacgg
tctccacccgactcccagtcagagcagctgctgctggagacagagaggctgctgggagag
gcttcgtctaactggagccaggcgaagagagtgctgcaggaagtcagggagctgagagac
ctgtacagacagatggacctgcagaccccggactcccacctcagacagacctctcagcac
agtcaataccggaagagtctgatgtga

DBGET integrated database retrieval system