KEGG   Rattus norvegicus (rat): 310678Help
Entry
310678            CDS       T01003                                 

Gene name
Hist2h3c2
Definition
(RefSeq) histone cluster 2, H3c2
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    310678 (Hist2h3c2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    310678 (Hist2h3c2)
  09165 Substance dependence
   05034 Alcoholism
    310678 (Hist2h3c2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    310678 (Hist2h3c2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   310678 (Hist2h3c2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 310678
NCBI-ProteinID: NP_001101168
RGD: 1306445
Ensembl: ENSRNOG00000060366
UniProt: D3ZJ08
Position
2q34
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtacaaagcagaccgcccgcaagtccaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcaccgtggcgctgcgggagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtgggtctgttcgaggacaccaacctgtgcgccatccacgccaaacgcgtcaccatc
atgcccaaggacatccagttggcccgtcgcatccgcggggagcgcgcctaa

DBGET integrated database retrieval system