KEGG   Rattus norvegicus (rat): 310681
Entry
310681            CDS       T01003                                 

Gene name
Hjv
Definition
(RefSeq) hemojuvelin precursor
  KO
K23100  hemojuvelin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    310681 (Hjv)
SSDB
Motif
Pfam: RGM_N RGM_C
Other DBs
NCBI-GeneID: 310681
NCBI-ProteinID: NP_001012080
RGD: 1310195
Ensembl: ENSRNOG00000021200
UniProt: Q5FWU4
Position
2
AA seq 422 aa
MGDRGRSPSLRSPHGSPPTLSTLTLLLLLCGQAHSQCKILRCNAEYVSSTLSLRGGGSPD
TPHGGGRGGPASGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGP
TASPPARGPALPGAGPAPLTPDPCDYEARFSRLHGRTPGFLHCASFGDPHVRSFHNHFHT
CRVQGAWPLLDNDFLFVQATSSPVASGANATTIRKITIIFKNMQECIDQKVYQAEVDNLP
AAFEDGSVNGGDRPGGSSLSIQTANLGSHVEIRAAYIGTTIIVRQTAGQLSFSIRVAEDV
ARAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAIAIDTARRLCKEGLPVEDAYFQSCVFD
VSVSGDPNFTVAAQSALDDARVFLTDLENLHLFPVDAGPPLSPATCLVRLLSVLFVLWFC
IQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgggggatcgaggccggtcccctagtctccggtccccccatggcagtcctccaactcta
agcaccctcactctcctgctgctcctctgtggacaggctcactcccagtgcaagatcctc
cgctgcaatgccgagtacgtctcgtccactctgagccttcggggagggggctcaccggac
acgccacatggaggcggccgtggtgggccggcctcaggtggcttgtgtcgcgccctgcgc
tcctacgctctctgcacgcggcgcaccgcccgcacctgccgcggggacctcgctttccac
tccgcggtgcatggcatagaggacctgatgatccagcacaactgctcacgccagggtccc
acggcctcgcccccggcccggggtcctgccctgcccggggccggcccagcgcccctgacc
ccagatccctgtgactatgaagcccggttttccaggctgcacggtcgaaccccgggtttc
ttgcattgtgcttcctttggagacccccatgtgcgcagcttccacaatcactttcacaca
tgccgcgtccaaggagcttggcccctactagataacgacttcctctttgtccaagccacc
agctccccggtagcatcgggagccaacgctaccaccatccggaagatcactatcatattt
aaaaacatgcaggaatgcattgaccagaaagtctaccaggctgaggtagacaatcttcct
gcagcctttgaagatggttctgtcaatgggggcgaccgacctgggggctcgagtttgtcc
attcaaactgctaaccttgggagccacgtggagattcgagctgcctacattggaacaact
ataatcgttcgtcagacagctggacagctctccttctccatcagggtagcggaggatgtg
gcacgggccttctctgctgagcaggatctacagctgtgtgttgggggatgccctccgagc
cagcgactctctcgctcagagcgcaatcgccgtggggcgatagccatagatactgccaga
aggttgtgtaaggaagggcttccggttgaagatgcctacttccaatcctgcgtctttgat
gtttcagtctccggtgaccccaactttactgtggcagctcagtcagctctggacgatgcc
cgagtcttcttgaccgatttggagaacttgcaccttttcccagtagatgcggggcctccc
ctctctccagccacctgcctagtccggcttctttcggtcctctttgttctgtggttttgc
attcagtaa

DBGET integrated database retrieval system