KEGG   Rattus norvegicus (rat): 310685Help
Entry
310685            CDS       T01003                                 

Gene name
Polr3c
Definition
(RefSeq) RNA polymerase III subunit C
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Module
rno_M00181  RNA polymerase III, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    310685 (Polr3c)
   00240 Pyrimidine metabolism
    310685 (Polr3c)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    310685 (Polr3c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    310685 (Polr3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    310685 (Polr3c)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     310685 (Polr3c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpc82 HTH_9 TFIIE_alpha
Motif
Other DBs
NCBI-GeneID: 310685
NCBI-ProteinID: NP_001012081
RGD: 1311545
Ensembl: ENSRNOG00000033560
UniProt: Q5XIL3
Position
2q34
AA seq 533 aa AA seqDB search
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTKASLDQVKKALCVLIHH
NLVIYHVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSA
VVKKVADRLTETMEDGKTMDYAEVSNAFVRLADTHFVQRCPLVPDTDSSDPGPPPPAPNL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKKPRCTDNEEPTPDDGIYWQVNLDR
FHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTPSGAPFTQPLSSNEIFRSLPVGY
NISKQVLDQYLTLLADDPLEFIGKAGDSGGGMYVINLHKALASLSTATLESVIQERFGSR
CARIFRLVLQKKHLEQKQVEDFAMIPAKEAKDMLYKMLSENFISLQEIPKTPDHAPSRTF
YLYTVNVLSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIMASMQATGAEE
VQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIESTMKRQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcagaaattaaactgtgctctttgttgctacaagagcattttggtgagatt
gtagaaaaaattggagtccacctaatcagaactgggagccagccacttagagtaattgcc
catgacacaaaagcatcactggaccaggtgaaaaaagccctttgtgtcctcattcaccat
aacctggtcatctatcatgtgcataaacgcggtgtggtggagtatgaagcccaatgcagc
cgggtactgcggatgcttcggtacccccggtacatctatactaccaaaacactgtatggt
gacactggagagctgattgttgaggagcttctgctgaatggcaaaatgacaatgtcggct
gttgtgaagaaagtagcagaccgactcacagagaccatggaggatggcaagaccatggac
tacgctgaggtgtcaaatgcatttgttcgactggcagatactcactttgtacagcgctgt
cccctggttcctgacactgacagttctgaccccgggccgccgccacctgccccaaacctt
gtcattaatgaaaaggacatgtacctagttcccaaactgagcttgataggaaaaggtaag
aggaggagatcatctgacgaagatgctgctggagagcccaaggccaagaaaccaagatgc
acagataatgaggagcccacaccagacgatgggatttattggcaagtcaacctggacaga
ttccaccagcacttccgtgaccaagcaattgtgagcgcagtggcaaaccgaatggaccag
acaagcagcgagattgtgcggacaatgctccgaatgagtgagattaccactccctctggt
gcgccgtttactcagccactgtcctccaatgagatcttcagatccctgcccgtcggatat
aatatctctaaacaggttctggatcagtacctcacgctgctggcagatgacccactagaa
tttattggaaaggctggcgacagtggcggaggaatgtatgtcatcaacctccataaggca
ttagcatccctatccactgcaactctggagtctgtcatccaagagagattcgggtctcgc
tgtgcccggatattccgtctggtgttgcagaagaagcacctggagcagaagcaggtggag
gactttgcaatgatccctgcaaaggaggcaaaggacatgctgtataagatgctctcggag
aacttcatatcactgcaggaaattcctaaaacgccagaccacgccccgtccaggaccttc
tatctgtacaccgtgaatgtgctgtcagccgccaggatgctgttgcacaggtgctacaag
agcatagccaacttgatagaaaggcggcaatttgaaacaaaagagaacaagcggctacta
gaaaagtctcagcgggtggaagccatcatggcatcaatgcaggccacgggtgcagaggag
gtacagctgcaggagatcgaggagatgatcacagcccccgagcggcagcagctggagaca
ctgaaacgcaacgttaacaagttggatgccagtgagatccaggtagatgaaaccatcttc
ttactggaatcatacatcgagagcaccatgaagagacagtga

DBGET integrated database retrieval system