KEGG   Rattus norvegicus (rat): 310685Help
Entry
310685            CDS       T01003                                 

Gene name
Polr3c
Definition
(RefSeq) RNA polymerase III subunit C
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05169  Epstein-Barr virus infection
Module
rno_M00181  RNA polymerase III, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    310685 (Polr3c)
   00240 Pyrimidine metabolism
    310685 (Polr3c)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    310685 (Polr3c)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    310685 (Polr3c)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    310685 (Polr3c)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     310685 (Polr3c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpc82 HTH_9 TFIIE_alpha NIT
Motif
Other DBs
NCBI-GeneID: 310685
NCBI-ProteinID: NP_001012081
RGD: 1311545
Ensembl: ENSRNOG00000033560
UniProt: Q5XIL3
Position
2q34
AA seq 533 aa AA seqDB search
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTKASLDQVKKALCVLIHH
NLVIYHVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSA
VVKKVADRLTETMEDGKTMDYAEVSNAFVRLADTHFVQRCPLVPDTDSSDPGPPPPAPNL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKKPRCTDNEEPTPDDGIYWQVNLDR
FHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTPSGAPFTQPLSSNEIFRSLPVGY
NISKQVLDQYLTLLADDPLEFIGKAGDSGGGMYVINLHKALASLSTATLESVIQERFGSR
CARIFRLVLQKKHLEQKQVEDFAMIPAKEAKDMLYKMLSENFISLQEIPKTPDHAPSRTF
YLYTVNVLSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIMASMQATGAEE
VQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIESTMKRQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcagaaattaaactgtgctctttgttgctacaagagcattttggtgagatt
gtagaaaaaattggagtccacctaatcagaactgggagccagccacttagagtaattgcc
catgacacaaaagcatcactggaccaggtgaaaaaagccctttgtgtcctcattcaccat
aacctggtcatctatcatgtgcataaacgcggtgtggtggagtatgaagcccaatgcagc
cgggtactgcggatgcttcggtacccccggtacatctatactaccaaaacactgtatggt
gacactggagagctgattgttgaggagcttctgctgaatggcaaaatgacaatgtcggct
gttgtgaagaaagtagcagaccgactcacagagaccatggaggatggcaagaccatggac
tacgctgaggtgtcaaatgcatttgttcgactggcagatactcactttgtacagcgctgt
cccctggttcctgacactgacagttctgaccccgggccgccgccacctgccccaaacctt
gtcattaatgaaaaggacatgtacctagttcccaaactgagcttgataggaaaaggtaag
aggaggagatcatctgacgaagatgctgctggagagcccaaggccaagaaaccaagatgc
acagataatgaggagcccacaccagacgatgggatttattggcaagtcaacctggacaga
ttccaccagcacttccgtgaccaagcaattgtgagcgcagtggcaaaccgaatggaccag
acaagcagcgagattgtgcggacaatgctccgaatgagtgagattaccactccctctggt
gcgccgtttactcagccactgtcctccaatgagatcttcagatccctgcccgtcggatat
aatatctctaaacaggttctggatcagtacctcacgctgctggcagatgacccactagaa
tttattggaaaggctggcgacagtggcggaggaatgtatgtcatcaacctccataaggca
ttagcatccctatccactgcaactctggagtctgtcatccaagagagattcgggtctcgc
tgtgcccggatattccgtctggtgttgcagaagaagcacctggagcagaagcaggtggag
gactttgcaatgatccctgcaaaggaggcaaaggacatgctgtataagatgctctcggag
aacttcatatcactgcaggaaattcctaaaacgccagaccacgccccgtccaggaccttc
tatctgtacaccgtgaatgtgctgtcagccgccaggatgctgttgcacaggtgctacaag
agcatagccaacttgatagaaaggcggcaatttgaaacaaaagagaacaagcggctacta
gaaaagtctcagcgggtggaagccatcatggcatcaatgcaggccacgggtgcagaggag
gtacagctgcaggagatcgaggagatgatcacagcccccgagcggcagcagctggagaca
ctgaaacgcaacgttaacaagttggatgccagtgagatccaggtagatgaaaccatcttc
ttactggaatcatacatcgagagcaccatgaagagacagtga

DBGET integrated database retrieval system