KEGG   Rattus norvegicus (rat): 310688
Entry
310688            CDS       T01003                                 

Gene name
Sh2d2a
Definition
(RefSeq) SH2 domain-containing protein 2A
  KO
K08273  SH2 domain-containing protein 2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    310688 (Sh2d2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    310688 (Sh2d2a)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   310688 (Sh2d2a)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 310688
NCBI-ProteinID: NP_997488
RGD: 1303076
Ensembl: ENSRNOG00000013294
Vega: OTTRNOG00000002276
UniProt: Q5I0Q2
Position
2
AA seq 376 aa
MEFCLAQTCPQGNHEATSPTFSTFQPMNLTQGRCQDLGCGGKPSMQALREQEVQLSPRVT
HTVASASAPGAAWVLESVNREEEEPGKGELSLQAETRAWVQKTQAHWLLLRTAPLWFHGF
ITRREAERLLQSQPLGCYLVRFSESAVTFVLSYRSRTCCRHFLLAQLGDGRHVVLGEDSA
HSQLQDLLQHYTECPLSPYGEMLTQPLARQTAEPAGLSLRGESDSGSRRQDPDTQHSLFI
QQGQAHAQAPGHKEKVRASQQKKTSQASRPRPPIPAKPQLPLEVYTSPAPRPHQALPINP
VYQEPDEPIAFYAMGRGSPGDAPSNIYAEVDGPREMLPIGHPTLHKCWSRPISGGQGKGV
QGKKSSRRPAGRGSPS
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagttctgcttggcccagacatgtccccaagggaatcatgaagccacctccccaacc
ttcagcaccttccagcccatgaacctgacccaggggagatgccaggacttgggttgtggg
ggcaagcccagcatgcaggctctgagggaacaggaggttcagctcagccccagggtcacc
cacacggtggcctctgcctcagccccaggagctgcctgggtcctagagagtgtcaacagg
gaggaagaggaacctgggaaaggtgaactgtcattgcaagctgagaccagagcatgggtt
cagaagacccaggcccactggctcttgctcaggactgccccgctttggttccatggcttc
attaccagaagggaagctgagaggctactgcagtcccaacctctaggatgctatctggtg
cgcttcagcgagagcgctgtgaccttcgtgctgtcctacaggagccgaacctgctgccgt
cacttcctccttgctcagctaggggatgggcgccacgtggtgctgggtgaagacagtgcc
cactcgcagcttcaggacctgcttcaacactacacagagtgccccctcagcccctacggg
gagatgctcacccaaccccttgctcgccagacagctgagcctgccggtctttccctaagg
ggtgaatcagactctggaagcagaagacaggacccagacacccagcacagcctgttcatc
caacaggggcaggcccatgcccaggccccaggacataaagagaaagtgagggcctcccaa
cagaagaagacttcccaggcatccagacccaggccccccattcctgccaagcctcagcta
cctcttgaagtctacacaagtcctgctccacgacctcatcaggccctacccattaacccc
gtctaccaggagcctgatgaacccatagccttctatgccatggggcggggcagccctggg
gatgctcctagtaatatctatgctgaggtggatggcccacgggaaatgctacccattggg
caccccaccctccataagtgctggtccaggcctatctcaggaggccagggaaagggggta
cagggaaagaaaagctcaagaaggccagcaggaagagggagcccctcctga

DBGET integrated database retrieval system