KEGG   Rattus norvegicus (rat): 310710Help
Entry
310710            CDS       T01003                                 

Gene name
Sec22b, Sec22l1
Definition
(RefSeq) SEC22 homolog B, vesicle trafficking protein
  KO
K08517  vesicle transport protein SEC22
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04145  Phagosome
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    310710 (Sec22b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    310710 (Sec22b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    310710 (Sec22b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310710 (Sec22b)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    310710 (Sec22b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Longin Synaptobrevin IMD Sec20
Motif
Other DBs
NCBI-GeneID: 310710
NCBI-ProteinID: NP_001020857
RGD: 1309988
Ensembl: ENSRNOG00000018673
UniProt: Q4KM74
Position
2q34
AA seq 215 aa AA seqDB search
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMT
FHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgctgacgatgatcgcccgcgtagcggacgggcttcctctggccgcctcgatg
caggaggacgagcagtcaggccgggaccttcagcagtatcagagtcaggctaagcaactc
tttcgaaagttgaatgaacagtcccctaccagatgtaccttggaagcaggagccatgact
tttcactacattattgagcagggggtgtgttacttggttttgtgtgaagctgccttccct
aagaagttggcctttgcctacctagaagacttgcactcggaatttgacgagcagcatggg
aagaaggtgcccactgtgtctaggccctattccttcatcgagtttgacaccttcattcag
aagaccaagaaactctacattgatagccgtgctcggagaaatctcggctccatcaacacc
gaattgcaagatgtgcagaggatcatggtggcgaatattgaagaagtcctacagcgggga
gaagcactctcagcattggattcgaaggctaacaatttgtccagtctatctaagaaatac
cgccaggatgcgaagtacctgaacatgcgttccacctacgccaagcttgcagcagtagcc
gtgttcttcatcatgctgatagtgtatgtgcggttttggtggctgtga

DBGET integrated database retrieval system