KEGG   Rattus norvegicus (rat): 310732
Entry
310732            CDS       T01003                                 

Gene name
Slc22a15
Definition
(RefSeq) solute carrier family 22, member 15
  KO
K08211  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 15
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    310732 (Slc22a15)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   310732 (Slc22a15)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    310732 (Slc22a15)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 310732
NCBI-ProteinID: NP_001101177
RGD: 1311184
Ensembl: ENSRNOG00000033051
UniProt: D4A271
Position
2q34
AA seq 548 aa
MEVEEAFQAVGEMGLYQMYLCFLLAVLLQLYVATEAILIALIGATPAYHWDMAELLPNQS
HSNQSSGKGQAFGDWLLTANGSEIHKHVHFSNSFTSIASEWFLIANRSYKVSAASSFFFS
GVFVGVISFGQLSDRFGRKKVYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMS
LVAFVLLNECVGAAYWALAGSIGGLFFAVGIAQYALLGYFIRSWRTLAILVNLQGTVVFL
LSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSYRETGSFLDLFR
YRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPSYPLCIYLINQ
RWFGRKRTLAAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYI
YTSELYPTVIRNVGLGTCSMFSRVGGIIAPFVPSLKDVQWSLPFIVFGATGLTSGLLSLL
LPETLNSPLLETFSDLQMYSYRRLGEEALSLQTLDPPQPLGKASSLGSESEEEEEEFYDA
NEETQMIK
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggaggtggaggaggcgttccaggcggtgggcgagatgggcctctatcagatgtacttg
tgcttcctgctggccgtgctgctgcagctttatgtggccacggaagccatcctcattgca
ctaattggagctacaccagcataccactgggacatggcggagctcctgcccaaccagagc
cacagcaaccagtcttcgggcaaaggccaggcctttggggactggcttctgaccgccaat
ggcagtgagatccacaagcacgtgcatttcagcaacagcttcacctctatcgcctctgag
tggttcttaattgccaaccggtcttacaaagtcagcgcagccagctcctttttcttcagt
ggggtgtttgttggcgtaatctcctttggtcagctttcagatcgcttcgggaggaaaaaa
gtctatctcacaggttttgctcttgacatcttatttgccattgcaaatggattttccccc
tcatacgaattcttcgcagtaactcgcttcttggtgggcatgatgaatggcgggatgtcc
ctggtggcctttgtcttgctaaatgagtgcgtgggcgccgcctactgggcacttgcagga
tcgattggcggtctcttctttgccgttggcatcgcacaatacgccctgttaggatacttc
atccgctcctggaggaccctagccattctggtcaaccttcagggaacagtagtctttctc
ttgtctttattcattcctgaatcacctcgttggttgtactcccagggtcggctgagtgag
gcggaggaggccctgtatctcattgccaagaggaaccgcaagctcaagtgcacgttctca
ctaacacatccggccaacaggagctacagggaaacaggaagcttcctggatctgttccgt
taccgggtcctcctaggacatactctgatcctgatgttcatctggtttgtgtgcagcttg
gtgtactacggtcttaccttgagtgcgggtgacctaggggggagcatttatgccaacctg
gctttatctggcctcatagagattccatcctaccctctctgcatctacctgattaaccaa
agatggtttggtcggaagcggacactagcggcgtttctgtgccttggaggactggcctgt
cttattgtgatgtttcttccagaaaaaaaagacacaggtgtgtttgccgtggtcaacagc
cattccttgtccctgctgggaaagctgaccatcagcgctgccttcaacattgtttacatc
tacacctctgagctgtaccccactgtcatccgaaacgttggcctcggaacgtgctccatg
ttctcccgagtcggtgggatcattgctcccttcgtcccctctctgaaggacgtgcagtgg
tccctgcccttcatcgtgtttggagccacaggcctgacctcaggcctcctgagcctgctc
ttgccagagactctgaacagtcctttgctggagacattctctgatcttcaaatgtactca
tatcggcggttaggggaggaagcgctgtctctacagaccttggatcctccacagcccctg
ggcaaggccagcagcttggggagcgagagtgaggaagaggaggaagagttctatgatgca
aatgaggagacacagatgatcaagtga

DBGET integrated database retrieval system