KEGG   Rattus norvegicus (rat): 310749Help
Entry
310749            CDS       T01003                                 

Gene name
Rsbn1, RGD1307231
Definition
(RefSeq) round spermatid basic protein 1
  KO
K22610  lysine-specific demethylase 9 [EC:1.14.11.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    310749 (Rsbn1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     310749 (Rsbn1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    310749 (Rsbn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 310749
NCBI-ProteinID: NP_001178639
RGD: 1307231
Ensembl: ENSRNOG00000019671
UniProt: D4A1U7
Position
2q34
AA seq 795 aa AA seqDB search
MFRSTRTTDQWRAGERLQCPAGHARAALARTADGGAVGPFKCVFVGEMAAQVGAVRVVRA
VAAQEEPDKEGKEKPHVGVSPRGVKRQRRVSSGGSQEKRGRPSQDPPLAPPHRRRRSRQH
PGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPGTSALFTFSPLTVSAA
GPKHKGHKERHKHHHHRGSDGDPVACVPGDLKHKDKQENGERSGGVPLMKAPKRETADEN
GKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQLNS
TSGVNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFTTHQEHSIRRNFLKTGTKFSNFI
HEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAA
YLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLV
GAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIP
TADMPKSPFKRRRSMNEIKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGV
LKAVQFGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQWVDEAKLNQMRR
EGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPVVETAQNTESNSNM
DCGLEVDSQCVRIKTESEERCTEMQLLTTASSSFPLPSELHLQDLKTQPIPVFKVESRLD
SDQQHSLQAHPSTPV
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtctacgagaacgaccgatcagtggagggcgggggagagactccaatgccca
gcgggccatgcgcgggcggcgcttgcgcgaaccgcggacgggggggcggtcgggccattt
aaatgtgtgtttgtgggtgaaatggctgcgcaggtcggagcggttcgcgtagtacgggcg
gtggcggcgcaggaggagccggacaaagaggggaaggagaaaccccatgttggggtttcg
ccgcggggagtgaagcggcagcgccgggtgagcagcgggggttctcaggagaagcggggg
cggccgagccaggacccccctctcgctccccctcatcggcggcgtcgtagccgccaacat
cccgggccgctgcctccaacgaatgccgccccaaccgtcccgggccctgttgaacctctg
ctcctgccgccgccgccgcctccgtcgctggcaccggccgggcccgctgtcgctgccccg
ctcccggccccaggcacctcggccctcttcaccttctcgcccctgacggtgagcgcggcc
gggcccaagcataagggccacaaggagaggcacaagcaccatcaccaccgcggctccgat
ggtgaccccgtcgcctgcgttccgggcgatctcaagcacaaggacaagcaggaaaacggc
gagaggagcggaggggtgcctctgatgaaggcccccaagagagaaacagcagatgaaaat
ggtaaaacccagagagctgatgattttgtcttgaagaaaataaagaagaaaaagaaaaag
aaacaccgagaagacatgagaggaagacgccttaaaatgtacaataaggaagtacaaacc
gtctgtgctggcctgacccgcatcagcaaagaaattctcacccaaggacagctaaatagc
acttcaggagttaataaggagtccttcaggtatttgaaggatgaacagctgtgcagatta
aatttgggcatgcaagaatatcgggtgccccagggagtacagacaccttttacaacgcac
caagaacattctattcgcagaaatttcttaaaaacaggtactaaatttagcaactttatt
catgaagaacaccagtccaatggtggtgctcttgtccttcatgcatacatggacgaactc
tcatttttgtctccaatggagatggagagattttctgaggagtttcttgctttgacattc
agtgaaaatgagaaaaatgctgcatactatgctttagcaatagtgcatggagcggctgct
tatctcccagacttcctggactactttgcttttaattttcccaacactccagtgaaaatg
gaaattttgggcaagaaagatattgaaacaaccaccatttcaaattttcatactcaggtc
aacaggacatattgctgtggtacctaccgagcaggtcctatgcgacagataagtcttgtt
ggagcagtagatgaagaagttggtgattatttcccagagttcctagatatgttagaagaa
tcaccatttctgaaaatgactttgccctggggtacactttccagcctccaactacaatgt
aggtctcagagtgatgatgggcctataatgtgggtgaggccaggagagcagatgatccct
acagcagatatgccaaagtcacccttcaaaagacgacgatcaatgaatgaaattaaaaat
ctccagtacctacctcggacaagtgaaccccgagaagtcctctttgaagataggacaaga
gctcatgctgatcatgtaggtcaggggtttgactggcagagtacggctgctgttggggtt
ttgaaggctgtacaatttggtgaatggagcgatcagcctcgcataaccaaagatgtgatt
tgttttcatgctgaggattttactgatgttgtacagagacttcagttggaccttcacgaa
cctccagtttcccagtgtgttcagtgggtggatgaagcaaaactaaaccaaatgaggcga
gaaggcattcgctatgctagaattcagctttgtgacaatgatatctacttcatccctaga
aatgtcattcatcagttcaaaacagtgtcagcagtgtgcagcttagcctggcatataagg
cttaaacaataccaccctgttgtggaaaccgctcaaaacacagagagcaattccaacatg
gactgtggtttagaagttgactcccagtgtgtgagaataaaaactgaatctgaggagaga
tgcacagagatgcagcttttgacaactgcttcatcgtctttcccacttccatcagaactt
catctacaggatctgaagacccagcctattccagtgttcaaggtggagagcagactggac
tctgaccaacaacacagtctgcaggcacatccaagcactcctgtgtga

DBGET integrated database retrieval system