KEGG   Rattus norvegicus (rat): 310772
Entry
310772            CDS       T01003                                 

Gene name
Dennd2d, RGD1305120
Definition
(RefSeq) DENN domain containing 2D
  KO
K20161  DENN domain-containing protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310772 (Dennd2d)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    310772 (Dennd2d)
SSDB
Motif
Pfam: DENN uDENN dDENN SPA
Other DBs
NCBI-GeneID: 310772
NCBI-ProteinID: NP_001101184
RGD: 1305120
Ensembl: ENSRNOG00000017680
UniProt: B0BNM5
Position
2q34
AA seq 466 aa
MDGLGRRLRASLRLKRGQRGQSQNNPGDAVTEPERIQEHSPPIFAGGQHFFEYLLVVSLK
KKHLGDDYEPTITYQFPKRENLLRGQQEEEERLLKAIPLFCFPDGNEWAPLTEYPRETFS
FVLTNVDGSRKIGYCRRLLPAGPGPRLPKVYCIISCIGCFGLFSKILDEVEKRHQISMAV
IYPFMQGLREAAFPAPGKTVTLKSFIPDSGTEFISLTRPLDSHLEHVDFSALLQCLHFEQ
IIQIFASAVLERKIIFLAEGLSTLSQCIHAAAALLYPFSWAHTYIPVVPESLLATVCCPT
PFMVGVQMRFQQEVMDSPMEEVLLVNLCKGTFLLSVGDEKDILPRKLQDDILDSLAQGIN
ELKTSEQINEHVSGPFVQFFVKTVGHYASYIKREASGQGHFQERSFCKAVTSKTKRRFVK
KFVKTQLFSLFIQEAEKSRNPPAGYFQKKILEYEEQKKQKKSRERR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggatgggctcggccgccgcctccgagccagcctgagactgaagcgcggccagcgggga
caatcccagaacaatcctggggatgctgtcacagaaccggaaagaatccaggagcattct
ccacctatctttgctggaggccagcacttctttgaataccttcttgttgtttctttaaag
aaaaagcatttaggggatgattatgaacccacaatcacctaccagtttcccaagagggag
aacctgctccgaggtcagcaggaggaggaggaacggctgctcaaagccatccctttgttc
tgcttccctgatgggaatgagtgggcaccgctcacagagtatcccagggagaccttctca
tttgtcctgaccaatgtggatgggagcaggaagatcggatactgcaggcgcctcctgcct
gctggtcctggtcctcgccttccaaaagtatactgcatcatcagctgcatcggctgcttc
ggcttgttctccaagatactggatgaagtagagaagagacatcagatctccatggctgtc
atctacccattcatgcaaggtctccgagaggcagcctttcctgcacctggaaagacagtc
acccttaagagcttcattcctgattcaggcacggagttcatctcattgacacggccccta
gactcccaccttgaacatgtggacttcagtgctctgctgcaatgcctccattttgagcag
attattcagatctttgcctctgcagtacttgaaagaaagatcatctttttggcagagggt
ctgagtaccctgtctcagtgtatccatgctgcagctgctctgctttacccatttagttgg
gcacacacatacatcccggtggtccctgagagccttctggccactgtctgctgccctacc
cccttcatggttggggtacagatgcgattccagcaggaggttatggacagtcccatggaa
gaggtcctgttggtgaatctttgtaaaggaaccttcttattatcagttggtgatgagaaa
gacatcctaccacggaaacttcaggatgacatcttggactctcttgctcaaggaataaat
gagttaaagacttcagaacaaatcaatgagcatgtttcaggcccttttgtacagttcttt
gtcaagactgtgggccactatgcctcctatataaaacgggaggccagtggacaaggccat
ttccaagaacgctccttctgtaaggctgttacctccaagaccaagcgccgatttgtgaag
aagtttgtgaagacacaacttttctccctattcatccaggaagcagagaagagcaggaat
cctcctgcaggctatttccaaaagaaaatacttgaatatgaagaacagaaaaaacagaag
aaatcaagagaaagacggtga

DBGET integrated database retrieval system