KEGG   Rattus norvegicus (rat): 310812
Entry
310812            CDS       T01003                                 

Gene name
Plppr5, Lppr5, PRG-5, Pap2d, RGD1309567
Definition
(RefSeq) phospholipid phosphatase related 5
  KO
K19581  lipid phosphate phosphatase-related protein type 1/2/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    310812 (Plppr5)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 310812
NCBI-ProteinID: NP_001101190
RGD: 1309567
Ensembl: ENSRNOG00000016878
UniProt: B3VQM3
Position
2q41
AA seq 316 aa
MPLLPAALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDS
SAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTV
RFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGN
PDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPVLCLGLMCLAFLTGLN
RVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQPENGHLHRDNVARMPMTNIPRV
ESPLEKNHITAFAEVT
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcccctgctgcccgcggcgctcatcagcagcatgctttatttccagatggtgatcatg
gcagggacggtgatgctggcttactacttcgaatacaccgacacgttcactgtgaacgtg
cagggattcttctgccacgacagcgcctaccgcaagccctacccgggcccagaggatagc
agcgcggtgcccccggtgctcctctactcgctggccgctggcgtcccggtgctcgtgata
atagttggagaaacagcagtgttttgcctacaattagccacaagggattttgaaaaccag
gaaaaaacgatcttaaccggagattgttgctatataaacccactggtacgccggactgtc
cgatttcttggaatttacgcctttggactgtttgccacagatatctttgtaaatgctggg
caagtggttacaggaaacctggctccacactttctggctttgtgtaagcccaactacaca
gcacttggatgtcagcaatacacacagttcatcagtggggaggaggcgtgcactggcaac
ccagacctcatcatgcgagcaaggaaaacattcccatccaaagaagctgccctcagtgtc
tatgccgccatgtatctgacgatgtacattaccaacacgatcaaagccaaaggaaccaga
ctggctaagcctgtcctgtgcttggggttaatgtgtttggcctttcttactggactcaat
agagtagcagaatatcggaatcattggtcagacgtgatagcaggctttctagttggaata
tcgatagcagtatttctggttgtatgcgtggtaaataacttcaaaggaagacaaccagaa
aatgggcacttacacagggacaatgtggcccggatgccgatgaccaacattcctcgagta
gaaagccctttggaaaagaaccacatcactgcctttgcagaagtcacatga

DBGET integrated database retrieval system