KEGG   Rattus norvegicus (rat): 310815
Entry
310815            CDS       T01003                                 

Gene name
Snx7
Definition
(RefSeq) sorting nexin 7
  KO
K17921  sorting nexin-7/30
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    310815 (Snx7)
SSDB
Motif
Pfam: PX DUF713 RNase_J_C CC2-LZ NuA4 Vps5
Other DBs
NCBI-GeneID: 310815
NCBI-ProteinID: NP_001012083
RGD: 1305480
Ensembl: ENSRNOG00000017077
UniProt: Q66H41
Position
2q41
AA seq 387 aa
MDMNSFSPMMPTSPLSMINQIKFEDGPDLKDLFITVDAPESHVTTIETFITYRIVTKTSR
GEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKA
LHKFLNRIADHPTLTFNEDFKVFLTAEAWELSSYKKQGPGLLSRMGQTVRAVASSMRGVK
NRPDEFTEMNNFIETFSQKINLIDKISQRIYKEERDYFDEMKEYGPIHTLWSTSEEDLVD
TLKGIASCIDQCCKATEKRMSGLSEALLPVVHEYVLYSEMLVGVMKRRDQIQAELDSKVE
ALTYKKADADLLTEEIGKLEDKVECANNALKADWERWRQNMQNDLRSAFTDTAEENIRYY
EQCLATWESFLTSQTDLPLEEDPEDKL
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggacatgaactcatttagccctatgatgccaacatcccctttgtcgatgataaaccaa
atcaagtttgaagatggaccagatttaaaggatctcttcattacagttgatgcaccagag
agccatgtcactacaattgaaactttcatcacttacaggatcgtaaccaagacatctcgt
ggggagtttgattccagtgagtttgaagtcaggcgacgttaccaagatttcctttggttg
aaggggaaactggaagaagctcatcccactctcattattcccccattgccagagaagttt
attgtgaaaggcatggtggaacgcttcaacgatgacttcattgagacccgcaggaaggca
ctacacaagtttctgaacaggatcgccgatcatccaactttaacatttaatgaggatttc
aaggttttcctcactgcagaagcctgggaactctcttcctataagaagcaagggcctggc
ttgctgagcaggatggggcagacagtcagagcagtggcgtcttctatgcgaggagtgaag
aaccggccagatgagttcacggagatgaataacttcattgaaacattcagccagaaaata
aacttgatagataaaatatctcagaggatttacaaggaagaaagggactattttgatgaa
atgaaagaatacggccctattcatactctatggtccacctcagaagaagacctggttgat
acgttgaaaggcattgccagctgcattgaccagtgctgtaaggccacggagaagcggatg
tctggcctgtccgaggctttgctccctgtcgtccatgagtatgtgctttacagtgagatg
ttagtgggtgttatgaaaagaagagatcaaatccaagcagaactggattccaaagtagaa
gctttgacctacaagaaagccgatgctgatctgcttacagaggaaatcgggaaacttgaa
gataaagtggagtgtgctaataatgccctgaaagcagactgggaaaggtggaggcagaac
atgcagaatgacctcaggtcagcatttacagacacggccgaggagaacatccgctactat
gagcagtgccttgctacatgggaatcattcctcacatcacagactgacctcccgttggaa
gaagatcccgaagataaactttga

DBGET integrated database retrieval system