KEGG   Rattus norvegicus (rat): 310843
Entry
310843            CDS       T01003                                 

Gene name
Sec24d
Definition
(RefSeq) SEC24 homolog D, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    310843 (Sec24d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    310843 (Sec24d)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    310843 (Sec24d)
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 310843
NCBI-ProteinID: NP_001296382
RGD: 1311720
Ensembl: ENSRNOG00000014872
UniProt: A0A0G2QC63
Position
2q42
AA seq 1034 aa
MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHVSSPPGMMKPPGPTGATAPSGLLPPG
PLPPGPPQFGPNGAHAAGHPPQRFPGHPPVNNAAPPYASGQPLPQSSYPGPGSTSSVTQL
GSQFGSMQINNYGVGVTPQGQGPPGPQSAGAFQGPPQPTQPSILQPGPQVPPPPPTAMNG
PGASPMSAPAHRQDGLPAPTPLNAQYQPPPPPGQTLGAGYHPQQAANYGPQMGGAQLSYP
GGFPGGPAQMAGPAPQLQRKLDPDSIPSPIQVIENDRATRGGQVYTTNTRGQVPPLVTTE
CMIQDQGHSSPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFADIPSNETPLYLVNHGES
GPVRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNDVPPFYFQHLDHIGRRLDHYEKPELS
LGSYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTVLKRLPKEEHE
EKSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYEESQSVIHN
LLDQIPEMFADSNENETVFAPVIQAGMEALKAAECPGKLFIFHSSLPTAEAPGKLKNRDD
KKLVNTDKEKILFQPQTAVYESLAKDCVANSCSVTLFLFPSQFVDVASLGLVPLLTGGSL
YKYNVFQVHVDSQRFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMNNTTDVEM
AAIDCDKAVTVEFKHDDKLSEDVGALIQCALLYTTIGGQRRLRIHNVALNCSTQLADLYK
SCETDALINFFAKSAFKAVLNQPLKTIREILVNQTAHMLACYRKHCASPSAASQLILPDS
MKVLPVYMNSLLKNCVLLSRPEISPDERAYQRQLVMTMGVADSQLFFYPLLLPIHTLDVK
SAALPPAVRCSESRLSEEGIFLLADGLNMFLWFGVGSPAELIQGIFNVPSFAHINTDMTS
LPEVGSPHSQQLRMIMNNIQQKKPYSMKLIIVKQREQREMVFRQFLVEDKGLYGGSSYVD
FLCCVHKEICQLLN
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgagccaacaaggttacgtggcgacacccccctattctcagtcccagcctggaatgggc
atttctccccctcactacgggcactatggggacccgtcccatgtgtcctctccaccaggc
atgatgaagcctccggggcctacaggagccactgctccttcagggctgctgcccccaggt
cctttacctcctggacccccacagtttggtcccaatggagcccatgccgcaggccatcct
cctcaaagatttccgggacacccacccgtcaataatgcagcacccccttatgcatcaggc
cagcccctgccacagtcatcttacccaggtcctgggtccacctcctctgtcacccagctg
ggcagtcagttcggctccatgcagatcaacaactatggtgtgggcgtgactccccagggc
cagggtccgcctggcccccagtcagcaggcgcctttcaggggcctccacagcctacacag
ccatctattctgcagccaggacctcaggttccaccaccaccacccaccgccatgaacggc
cctggtgcctctccaatgtctgcaccagctcacaggcaagatggacttcctgcgcctact
cctctgaatgcccagtatcaacctccacctccaccaggccagaccctgggtgctggttac
catccacagcaagcagccaactatggaccacagatgggaggtgcacagctgtcctaccca
ggaggttttcctggaggtccggcacagatggctgggccagcacctcagctccagaggaag
cttgatccagactccatccccagccccattcaagtgatcgagaatgacagggccaccaga
ggcggacaggtctataccaccaacaccaggggccaggtgcctccactggtcaccaccgag
tgtatgattcaagatcaaggccactcgagcccccgctacattcgctgtaccacatactgc
ttcccatgcacgtcagacatggccaagcaagcccagatcccactagctgccgtcatcaaa
ccctttgctgacattccatcaaacgagacccccttgtacttggtgaaccatggagagagc
ggaccagtgagatgcaacaggtgcaaagcctacatgtgcccgttcatgcagttcatcgaa
ggcggacggcgctatcagtgcggattttgcagctgcgtgaacgatgtcccaccgttctat
ttccaacatctggaccacattgggagaagactggaccactatgagaagccagagctgtct
ttaggatcctatgaatatgttgctactttggattactgcagaaagaataaaccacccaac
ccaccagcctttatcttcatgatcgatgtctcgtacagtaacataaagaacgggctcgtc
aagctcatctgtgaggaactgaagaccgtgctgaagaggctacccaaggaggagcatgag
gagaaatctgcaattcgagttggtttcatcacatacaacaaagttctccacttctttaac
gtgaagagtaatctggcccaacctcagatgatggtggtgacggatgttggagaggtcttt
gttcctttgttggatgggttccttgtcaactatgaagaatcccagtctgtgatccacaat
ttattggaccagattcctgagatgtttgccgactccaatgaaaacgagacagtctttgct
cctgtcatccaggctggcatggaggccctgaaggcagcagagtgccctgggaagctcttc
atcttccattcgtccctgcctactgccgaagcaccgggaaagctcaagaacagagacgac
aaaaagctggttaacacagacaaggagaagatacttttccagccccaaacagctgtctac
gaatctctggccaaggactgtgtagccaacagctgctcggtgactctgttcctctttccc
agtcagtttgtggatgtggcttccttgggtctggttcctctgctcacgggaggatccctt
tacaaatacaatgtttttcaggtacacgtggatagtcaaaggtttttgaacgacctccgg
aatgatattgagaagaaaataggcttcgatgctatcatgagggttcggaccagcacaggt
ttcagggccaccgatttcttcggtgggatattcatgaacaacaccacagatgtggaaatg
gcagccatcgactgtgataaggcggtgaccgtggagttcaagcacgatgacaagctcagt
gaagatgtcggggctctgatccagtgtgccctgctctacacgaccatcggtggtcagcga
agactccggattcacaatgtcgccttaaactgcagcacccagctagcagatctgtacaag
agctgtgaaacagatgccctgatcaacttctttgccaagtcagcttttaaagccgttttg
aaccagcctttgaagaccatccgggaaattctagttaatcagactgcccatatgttggcg
tgttaccggaagcactgtgcgagcccttctgcagcaagccagcttatactgccagattcc
atgaaagttctgcccgtgtacatgaacagtctgttgaaaaactgtgtgctgctcagcaga
cccgagatctcccctgacgagcgggcgtaccaacggcagctggtgatgaccatgggcgtg
gctgactcccagctcttcttctatccactgctcctgccaatacacacgttggatgtgaag
agcgcagcactgccgccggctgtccgctgctccgagtcccgactctccgaagaaggaata
ttcctgctggctgatggtctgaacatgttcttgtggttcggagtggggagcccagcggag
ctgattcagggaatattcaatgtgccatcgtttgcacatatcaacacagatatgacatcg
ctgcctgaggtgggaagtccgcactctcaacaactcaggatgattatgaataatatccag
cagaagaagccatactcaatgaagctcatcatagtgaagcagcgagagcagcgggagatg
gttttccgacagttcctggtggaagacaaagggctctacggaggatcatcttatgtggat
ttcctctgctgtgtgcacaaggagatctgtcagctgcttaactga

DBGET integrated database retrieval system