KEGG   Rattus norvegicus (rat): 310849
Entry
310849            CDS       T01003                                 

Gene name
Sgms2
Definition
(RefSeq) phosphatidylcholine:ceramide cholinephosphotransferase 2
  KO
K04714  shingomyelin synthase [EC:2.7.8.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    310849 (Sgms2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    310849 (Sgms2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.27  sphingomyelin synthase
     310849 (Sgms2)
SSDB
Motif
Pfam: PAP2_C PAP2
Other DBs
NCBI-GeneID: 310849
NCBI-ProteinID: NP_001014065
RGD: 1305778
Ensembl: ENSRNOG00000011284
UniProt: Q4JM44 A0A0G2JSK7
Position
2
AA seq 365 aa
MDIIETAKLEGHLESQTNNSTNTYTSPTEAVEEEDKNGKGKPKTLSNGLRKGAKKYPDYI
QISMPNDSRNKLPLEWWKTGIAFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDY
VDRVKWAFSVSEINGMVLVGLWLTQWLFLRYKSIVGRRFFFIMGTLYLYRCITMYVTTLP
VPGMHFQCAPKLNGDSQAKIQRILRLLSGGGLSITGSHILCGDFLFSGHTVVLTLTYLFI
KEYSPRHFWWYHLVCWLLSAAGIVCILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNL
KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKKYSRVQKIGED
NEKST
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggatatcatagagacagcaaaacttgaaggtcatttggaaagtcaaaccaacaactct
accaacacttacacaagccccactgaagctgtagaagaggaggacaaaaatggcaagggt
aaacccaagaccttatccaacgggctacgaaagggtgccaagaaatacccggactacatc
cagatttccatgcccaatgactccaggaacaagcttcccctagagtggtggaaaacaggc
attgcctttgtgtacgctctcttcaaccttatcctgacaacagtcatgatcaccgttgtg
cacgagagggtccctcccaaggaactcagccctccactcccagacaagttttttgattac
gtcgaccgggtcaaatgggcattttctgtatcagaaataaatgggatggtattagttggg
ctatggctcacccagtggctctttctgagatacaagtcaatagtgggacgcagattcttc
tttatcatgggaactttatacctgtatcgctgtataactatgtacgtcactacgttacct
gtgcccggaatgcacttccagtgtgctccaaagctcaatggagactctcaggcaaaaata
caacggattctccggttgctttctggtggtggattgtccatcacgggatcacacatcctg
tgtggagacttcctcttcagcggccatacagttgtgctgacacttacttacttgttcatc
aaagaatattcacctcgtcacttctggtggtaccacttggtctgctggctgctgagcgcc
gctgggatcgtctgcatcctcgtggcgcacgaacactacacggtcgatgtcatcattgcg
tattacatcacaacacggctgttttggtggtaccactccatggccaatgaaaagaacttg
aaggtctcttcccagactaatttcttgtctcgggcttggtggttccccatcttctatttt
tttgaaaagaatgtgcaaggctccattccttgctgtttctcctggccgctgtcctggccc
cctggctgcttcaagtcatcgtgcaaaaagtattctcgagtccagaagatcggggaggat
aatgagaagtctacctga

KEGG   Rattus norvegicus (rat): 353229
Entry
353229            CDS       T01003                                 

Gene name
Sgms1
Definition
(RefSeq) phosphatidylcholine:ceramide cholinephosphotransferase 1
  KO
K04714  shingomyelin synthase [EC:2.7.8.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    353229 (Sgms1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    353229 (Sgms1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.27  sphingomyelin synthase
     353229 (Sgms1)
SSDB
Motif
Pfam: PAP2_C SAM_3 PAP2 SAM_1 SAM_PNT SAM_2
Other DBs
NCBI-GeneID: 353229
NCBI-ProteinID: NP_852051
RGD: 727912
Ensembl: ENSRNOG00000012536
UniProt: Q7TSX5
Position
1
AA seq 419 aa
MLSASTMKEVVYWSPKKVADWLLENAMPEYCEPLGHFTGQDLINLTQEDFTKPPLCRVSS
DNGQRLLDMIETLKMEHHIEAHKNGHANGHLSIGVDIPNPDGSFSIKIKPNGMPNGFRKE
MIKIPMPEPERSQYPMEWGKTLLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFF
DHFNRVQWAFSICEINGMILVGLWLFQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTT
LPVPGMHFNCSPKLFGDWEAQVRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYL
FIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQ
VLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPLPWPVVHLSRQVKYSRLVNDT
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgttgtctgccagtaccatgaaggaagtggtttactggtcacccaagaaggtggcagac
tggctgctggagaatgctatgccagaatactgtgaacctctggggcatttcacaggccag
gacctaatcaacctaacccaagaggatttcacaaagcctcctctgtgccgagtctcctct
gacaatgggcagcggctcttagacatgatagagaccctgaagatggagcaccatatcgaa
gcgcacaagaatggccacgccaacggacacctcagcattggcgtcgacattcccaaccct
gacggcagcttcagcatcaagattaaacccaacggaatgccaaatggcttcaggaaagag
atgatcaagatccccatgccggaacccgagcgctcccagtaccccatggagtggggcaag
actttgctggcctttctttacgcactgtcctgttttgttctcactacagtgatgatctcg
gtcgtccatgaacgagtgcctcctaaggaggtacagcctccgctaccggacacgtttttt
gaccattttaaccgggtgcagtgggcgttttctatttgcgaaattaacggcatgatcctt
gtaggactctggttatttcagtggctgctcttaaaatacaagtctattattagcagaaga
tttttctgcatagttggcacgctgtacctgtaccggtgtattacaatgtatgtaactaca
ctcccagtacccggcatgcacttcaactgttctccgaagctctttggagactgggaagct
caagtgcggaggataatgaagctcattgctggaggtggcttgtccatcacgggctcgcac
aacatgtgtggggactatctgtacagtggacacacagtcatgctaacgctcacctacctg
tttatcaaggagtattcccctcggcggctctggtggtaccactggatttgctggctcctc
agcgtcgttggaatcttctgtattctcttagcgcatgaccactacactgtggacgtggtg
gtagcatattacatcaccacaagactcttctggtggtatcacacgatggccaatcagcaa
gtgctgaaggaagcttcccagatgaacctcctggccagagtgtggtggtacaggccattt
cagtactttgaaaagaacgtccaagggattgtacctcgatcttaccattggccccttccc
tggccggtagtccaccttagtaggcaagttaaatatagccggctggtaaacgacacctaa

DBGET integrated database retrieval system